Property Summary

NCBI Gene PubMed Count 21
PubMed Score 81.36
PubTator Score 17.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -2.500 2.1e-02
dermatomyositis 1.500 4.7e-03
Down syndrome 1.100 4.5e-03
ependymoma 1.100 3.7e-07
gastric cancer 1.200 2.4e-02
group 3 medulloblastoma 1.200 9.0e-03
hepatocellular carcinoma 1.700 6.8e-05
lung carcinoma 1.100 6.7e-11
malignant mesothelioma 1.100 3.3e-06
Multiple myeloma 1.165 1.0e-02
ovarian cancer -2.000 4.5e-08
psoriasis 1.500 3.0e-04
tuberculosis and treatment for 6 months -1.200 1.5e-04
Waldenstrons macroglobulinemia 1.775 1.1e-03

 GO Function (1)

Gene RIF (4)

AA Sequence

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL      1 - 70
KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR     71 - 140
AMIEEFDKDGDGEINQEEFIAIMTGDI                                               141 - 167
//

Text Mined References (24)

PMID Year Title