Property Summary

NCBI Gene PubMed Count 21
Grant Count 27
R01 Count 21
Funding $1,823,601.39
PubMed Score 78.33
PubTator Score 17.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.200 0.024
hepatocellular carcinoma 1.700 0.000
Waldenstrons macroglobulinemia 1.775 0.001
Multiple myeloma 1.165 0.010
malignant mesothelioma 1.100 0.000
psoriasis 1.500 0.000
posterior fossa group B ependymoma 1.500 0.000
group 4 medulloblastoma 1.700 0.000
tuberculosis and treatment for 6 months -1.200 0.000
lung carcinoma 1.100 0.000
acute myeloid leukemia -2.500 0.021
ovarian cancer -2.000 0.000
Down syndrome 1.100 0.005
dermatomyositis 1.500 0.005

 GO Function (1)

Gene RIF (4)

PMID Text
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
20508983 Observational study of gene-disease association. (HuGE Navigator)
16101678 Studies using a combined approach of immunofluorescence detection of Gag protein and in situ hybridization detection of viral genomic RNA indicate Gag co-localizes with Psi+ RNA in the perinuclear region and also co-localizes with centrins
15654740 could be classified as a Ca(2+) sensor protein

AA Sequence

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKIL      1 - 70
KDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR     71 - 140
AMIEEFDKDGDGEINQEEFIAIMTGDI                                               141 - 167
//

Text Mined References (24)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
26337392 2015 MDM1 is a microtubule-binding protein that negatively regulates centriole duplication.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19734900 2009 Genetic variant near IRS1 is associated with type 2 diabetes, insulin resistance and hyperinsulinemia.
More...