Property Summary

NCBI Gene PubMed Count 56
Grant Count 36
R01 Count 12
Funding $6,689,347.87
PubMed Score 154.41
PubTator Score 55.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.001
osteosarcoma 1.731 0.000
atypical teratoid / rhabdoid tumor 1.100 0.017
pulmonary arterial hypertension -2.200 0.045

Gene RIF (46)

PMID Text
26435504 The distinct expression patterns of T gene isoforms may contribute to the pathogenesis of skull base chordomas.
26099010 Nuclear brachyury expression is prevalent in embryonal carcinoma, seminoma, and small cell carcinoma of the lung but very rare in common carcinomas, sarcomas, and melanoma.
26015544 The data illuminate the function of BRA in the context of human embryonic development and show that the regulatory role of BRA is context dependent.
25744730 we found that Brachyury expression was inversely correlated with CCL2 and CCL4 expression in human lung tumors
25683840 Brachyury expression promotes lung cancer cell proliferation and invasion, and correlates with reduced patient survival.
25499255 Elevated Brachyury facilitates hepatocellular carcinoma metastasis by promoting EMT via PTEN/Akt/Snail-dependent pathway.
25433496 Brachyury plays an important role in regulating TGF beta 1-mediated renal epithelial mesenchymal transition and could be an attractive target for progression of renal disease therapies
25009296 the present study suggests that Brachyury plays an important role in prostate cancer aggressiveness and points, for the first time, to Brachyury as a significant predictor of poor prostate cancer prognosis
24990759 Importance of the T gene in the pathogenesis of both familial and sporadic chordoma.
24815864 The level of brachyury expression in breast cancer cells was positively associated with their ability to invade the extracellular matrix, efficiently form mammospheres in vitro, and resist the cytotoxic effect of docetaxel
More...

AA Sequence

MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTNEMIVTKNGRR      1 - 70
MFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAP     71 - 140
VSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKY    141 - 210
NPFAKAFLDAKERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYP    211 - 280
TLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSL    281 - 350
WSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQ    351 - 420
GRLIASWTPVSPPSM                                                           421 - 435
//

Text Mined References (58)

PMID Year Title
26435504 2015 T gene isoform expression pattern is significantly different between chordomas and notochords.
26099010 2015 Nuclear Brachyury Expression Is Consistent in Chordoma, Common in Germ Cell Tumors and Small Cell Carcinomas, and Rare in Other Carcinomas and Sarcomas: An Immunohistochemical Study of 5229 Cases.
26015544 2015 Brachyury and SMAD signalling collaboratively orchestrate distinct mesoderm and endoderm gene regulatory networks in differentiating human embryonic stem cells.
25744730 2015 T-box transcription factor Brachyury in lung cancer cells inhibits macrophage infiltration by suppressing CCL2 and CCL4 chemokines.
25683840 2015 Impact of Brachyury on epithelial-mesenchymal transitions and chemosensitivity in non-small cell lung cancer.
25499255 2014 Overexpression of brachyury contributes to tumor metastasis by inducing epithelial-mesenchymal transition in hepatocellular carcinoma.
25433496 2014 The T-box transcription factor Brachyury promotes renal interstitial fibrosis by repressing E-cadherin expression.
25009296 2014 T-box transcription factor brachyury is associated with prostate cancer progression and aggressiveness.
24990759 2014 Characterization of T gene sequence variants and germline duplications in familial and sporadic chordoma.
24815864 2014 Overexpression of the EMT driver brachyury in breast carcinomas: association with poor prognosis.
More...