Property Summary

NCBI Gene PubMed Count 63
PubMed Score 158.44
PubTator Score 55.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.7e-02
osteosarcoma 1.731 5.0e-07
psoriasis 1.200 1.0e-03
pulmonary arterial hypertension -2.200 4.5e-02

Gene RIF (53)

AA Sequence

MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTNEMIVTKNGRR      1 - 70
MFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAP     71 - 140
VSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKY    141 - 210
NPFAKAFLDAKERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYP    211 - 280
TLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSL    281 - 350
WSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQ    351 - 420
GRLIASWTPVSPPSM                                                           421 - 435
//

Text Mined References (65)

PMID Year Title