Property Summary

NCBI Gene PubMed Count 20
PubMed Score 91.57
PubTator Score 21.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 5.70858129828562E-8
Atopic dermatitis 944 2.60625624891288E-7
psoriasis 6685 2.74473255278222E-6
group 4 medulloblastoma 1875 3.97161647875704E-5
osteosarcoma 7933 5.00072778062362E-5
glioblastoma 5572 2.6305425634768E-4
ductal carcinoma in situ 1745 8.21668232478578E-4
Multiple myeloma 1328 0.00238751486654463
invasive ductal carcinoma 2950 0.00502280916281863
Breast cancer 3099 0.0372941328919976
Disease Target Count Z-score Confidence
triple-A syndrome 18 3.12 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.045 0.002
psoriasis -1.300 0.000
osteosarcoma -2.280 0.000
glioblastoma -1.200 0.000
Atopic dermatitis -1.300 0.000
Breast cancer 2.100 0.037
group 4 medulloblastoma 1.800 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.400 0.005
ovarian cancer -2.500 0.000

Synonym

Accession O15173 Q569H1
Symbols DG6
PMBP

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (12)

PMID Text
23970345 Reversely, in the HO-8910 cells treated with CDDP alone, levels of both PGRMC1 and PGR were increased while the level of PGRMC2 was decreased
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of progesterone receptor membrane component 2 (PGRMC2) expression by HIV-1 Vpr in Vpr transduced macrophages
23793472 In secretory phase endometrium from women with advanced stage endometriosis, PGRMC-2 expression is downregulated.
23276631 It deserves further examination as data point to a role of PGRMC2 as tumor suppressor, migration inhibitor and regulator of cytochrome P450 proteins.
23064006 PGRMC2 inhibits migration of SKOV-3 ovarian cancer cells in vitro.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of progesterone receptor membrane component 2 (PGRMC2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYR      1 - 70
LWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPA     71 - 140
GPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEY    141 - 210
TDEEDTKDHNKQD                                                             211 - 223
//

Text Mined References (32)

PMID Year Title
27599036 2016 A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23970345 2013 Progesterone protects ovarian cancer cells from cisplatin-induced inhibitory effects through progesterone receptor membrane component 1/2 as well as AKT signaling.
23793472 2014 Expression patterns of progesterone receptor membrane components 1 and 2 in endometria from women with and without endometriosis.
23276631 2013 PGRMC2, a yet uncharacterized protein with potential as tumor suppressor, migration inhibitor, and regulator of cytochrome P450 enzyme activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064006 2012 In vitro inhibition of SKOV-3 cell migration as a distinctive feature of progesterone receptor membrane component type 2 versus type 1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...