Property Summary

NCBI Gene PubMed Count 21
PubMed Score 95.54
PubTator Score 21.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.300 2.6e-07
Breast cancer 2.100 3.7e-02
ductal carcinoma in situ -1.100 8.2e-04
glioblastoma -1.200 2.6e-04
group 4 medulloblastoma 1.800 4.0e-05
invasive ductal carcinoma -1.400 5.0e-03
Multiple myeloma 1.045 2.4e-03
osteosarcoma -2.280 5.0e-05
ovarian cancer -1.600 5.6e-06
psoriasis -1.300 2.7e-06

Gene RIF (13)

AA Sequence

MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYR      1 - 70
LWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPA     71 - 140
GPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEY    141 - 210
TDEEDTKDHNKQD                                                             211 - 223
//

Text Mined References (33)

PMID Year Title