Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $86,401.8
PubMed Score 91.57
PubTator Score 21.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.045 0.002
psoriasis -1.300 0.000
osteosarcoma -2.280 0.000
glioblastoma -1.200 0.000
Atopic dermatitis -1.300 0.000
Breast cancer 2.100 0.037
group 4 medulloblastoma 1.800 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.400 0.005
ovarian cancer -2.500 0.000

Synonym

Accession O15173 Q569H1
Symbols DG6
PMBP

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (12)

PMID Text
23970345 Reversely, in the HO-8910 cells treated with CDDP alone, levels of both PGRMC1 and PGR were increased while the level of PGRMC2 was decreased
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of progesterone receptor membrane component 2 (PGRMC2) expression by HIV-1 Vpr in Vpr transduced macrophages
23793472 In secretory phase endometrium from women with advanced stage endometriosis, PGRMC-2 expression is downregulated.
23276631 It deserves further examination as data point to a role of PGRMC2 as tumor suppressor, migration inhibitor and regulator of cytochrome P450 proteins.
23064006 PGRMC2 inhibits migration of SKOV-3 ovarian cancer cells in vitro.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of progesterone receptor membrane component 2 (PGRMC2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYR      1 - 70
LWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPA     71 - 140
GPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEY    141 - 210
TDEEDTKDHNKQD                                                             211 - 223
//

Text Mined References (32)

PMID Year Title
27599036 2016 A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23970345 2013 Progesterone protects ovarian cancer cells from cisplatin-induced inhibitory effects through progesterone receptor membrane component 1/2 as well as AKT signaling.
23793472 2014 Expression patterns of progesterone receptor membrane components 1 and 2 in endometria from women with and without endometriosis.
23276631 2013 PGRMC2, a yet uncharacterized protein with potential as tumor suppressor, migration inhibitor, and regulator of cytochrome P450 enzyme activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064006 2012 In vitro inhibition of SKOV-3 cell migration as a distinctive feature of progesterone receptor membrane component type 2 versus type 1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...