Property Summary

NCBI Gene PubMed Count 3
Grant Count 7
Funding $445,565.33
PubMed Score 53.11
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Serine deficiency 9 6.577 3.3
Microcephaly 149 3.145 1.6

Gene RIF (1)

PMID Text
24650299 Deletion of PSPHL does not contribute to breast cancer in African American women.

AA Sequence

MASASCSPGGALASPEPGRKILPRMISHSELRKLFYSADAVCFDVDSTVISEEGIGCFHWIWRKCDQATS      1 - 70
QG                                                                         71 - 72
//

Text Mined References (3)

PMID Year Title
24650299 2014 PSPHL and breast cancer in African American women: causative gene or population stratification?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9573387 1998 Identification of a novel c-DNA overexpressed in Fanconi's anemia fibroblasts partially homologous to a putative L-3-phosphoserine-phosphatase.