Property Summary

NCBI Gene PubMed Count 163
Grant Count 258
R01 Count 172
Funding $30,538,586.75
PubMed Score 280.40
PubTator Score 217.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.300 0.000
osteosarcoma 1.295 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000

Synonym

Accession O15169 Q4TT26 Q4TT27 Q86YA7 Q8WVW6 Q96S28
Symbols AXIN
PPP1R49

Gene

PANTHER Protein Class (2)

PDB

1EMU   1DK8   1O9U   3ZDI   4B7T   4NM0   4NM3   4NM5   4NM7   4NU1  

Gene RIF (90)

PMID Text
27138857 The pool of ADP-ribosylated Axin, which is degraded under basal conditions, increases immediately following Wnt stimulation in both Drosophila and human cells.
26974125 Cancer point mutations in the scaffold protein Axin derail Wnt signaling and promote tumor growth in vivo through a gain-of-function mechanism.
26393419 GSK3 acts through APC motifs R2 and B to regulate APC:Axin interactions, promoting high-throughput of betacatenin to destruction.
26214021 Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway.
25802106 We have offered primary evidence that the T allele and T/T genotype of rs370681 polymorphisms and C/T genotype of rs1805105 polymorphisms in AXIN1 gene are more frequent in patients with cryptorchidism.
25735981 suggest a novel mechanism of Wnt signaling through the dissociation of the beta-catenin destruction complex by Axin1 Thr160 modification
25355064 Significantly increased atrial septal defect risk was observed to be associated with the A allele of rs12921862
24846767 Higher expression of AXIN1 protein in IUGR placentae indicates a role of Wnt/beta-catenin signaling pathway in pathology of placental development.
24722208 In adenomatous polyposis coli, beta-catenin phosphorylation involves Axin and the 20 amino acids of APC or APCL.
24419084 Which destabilize beta-catenin through stabilizing Axin.
More...

AA Sequence

MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGY      1 - 70
EPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKL     71 - 140
ARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEY    141 - 210
TRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRV    211 - 280
SSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRK    281 - 350
QHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE    351 - 420
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPG    421 - 490
HRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQS    491 - 560
SFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQ    561 - 630
KIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPA    631 - 700
PNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQR    701 - 770
KVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV    771 - 840
REDEAVLPVFEEKIIGKVEKVD                                                    841 - 862
//

Text Mined References (167)

PMID Year Title
27138857 2016 Wnt pathway activation by ADP-ribosylation.
27098453 2016 WDR26 is a new partner of Axin1 in the canonical Wnt signaling pathway.
26974125 2016 Axin cancer mutants form nanoaggregates to rewire the Wnt signaling network.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26393419 2015 A novel GSK3-regulated APC:Axin interaction regulates Wnt signaling by driving a catalytic cycle of efficient ?catenin destruction.
26214021 2015 5-hydroxytryptamine receptor (5-HT1DR) promotes colorectal cancer metastasis by regulating Axin1/?-catenin/MMP-7 signaling pathway.
25873176 2015 TGIF governs a feed-forward network that empowers Wnt signaling to drive mammary tumorigenesis.
25802106 2015 The variations in the AXIN1 gene and susceptibility to cryptorchidism.
25735981 2015 Thr160 of Axin1 is critical for the formation and function of the ?-catenin destruction complex.
25355064 2014 Association between polymorphisms in AXIN1 gene and atrial septal defect.
More...