Property Summary

NCBI Gene PubMed Count 18
PubMed Score 26.52
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 2.7e-02
atypical teratoid / rhabdoid tumor -2.600 6.1e-05
breast carcinoma 1.400 1.1e-03
Down syndrome 1.300 1.0e-03
glioblastoma -1.200 3.6e-03
group 3 medulloblastoma 1.100 1.2e-02
interstitial cystitis 1.100 3.3e-03
intraductal papillary-mucinous adenoma (... -1.800 1.5e-02
medulloblastoma, large-cell -3.100 5.8e-04
osteosarcoma -1.263 2.6e-03
ovarian cancer 2.100 1.5e-03
Pick disease -1.400 1.8e-02
primitive neuroectodermal tumor -1.700 1.2e-02
progressive supranuclear palsy -1.700 2.0e-02
psoriasis -1.600 1.5e-07
subependymal giant cell astrocytoma -1.527 1.7e-02
tuberculosis -1.500 5.0e-04

 GO Function (1)

Gene RIF (5)

AA Sequence

MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNSELEFAQIII      1 - 70
IVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDR     71 - 140
FTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPN    141 - 210
RTIFDSDLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSR    211 - 280
LQFQQNNAESTIVPIKGKDRKPGNLV                                                281 - 306
//

Text Mined References (19)

PMID Year Title