Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.62
PubTator Score 9.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Malignant neoplasm of pancreas 14
Disease Target Count P-value
tuberculosis 1563 9.24194566653811E-8
psoriasis 6685 1.45653019499767E-7
atypical teratoid / rhabdoid tumor 4369 6.10464904832166E-5
sonic hedgehog group medulloblastoma 1482 8.21617992795911E-5
medulloblastoma, large-cell 6234 5.80414047400811E-4
Down syndrome 548 9.97871124326566E-4
breast carcinoma 1614 0.00106340344112514
glioblastoma 5572 0.00138990048012043
ovarian cancer 8492 0.0014868360862716
osteosarcoma 7933 0.00255534968156249
pediatric high grade glioma 2712 0.00269543872495216
interstitial cystitis 2299 0.00326149857733471
primitive neuroectodermal tumor 3031 0.0115265726501084
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0149551213156961
subependymal giant cell astrocytoma 2287 0.0173390906570554
Pick disease 1893 0.0182580362266183
progressive supranuclear palsy 674 0.019588365945695
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
pancreatic cancer 2300 0.0 1.0

Expression

  Differential Expression (17)

Synonym

Accession O15165 B3KNT9 E9PAY9 K7EN38 O15166 O15167 O15168 Q5U646 Q6NXP3
Symbols C18orf1

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 GO Function (1)

Pathway (1)

Gene RIF (4)

PMID Text
24627487 Data suggest that C18ORF1 acts as a gatekeeper that abrogates excessive TGF-beta signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19430479 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNSELEFAQIII      1 - 70
IVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDR     71 - 140
FTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPN    141 - 210
RTIFDSDLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSR    211 - 280
LQFQQNNAESTIVPIKGKDRKPGNLV                                                281 - 306
//

Text Mined References (18)

PMID Year Title
24627487 2014 C18 ORF1, a novel negative regulator of transforming growth factor-? signaling.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19461657 2009 Analysis of a t(18;21)(p11.1;p11.1) translocation in a family with schizophrenia.
19430479 2009 Genome-wide association study of blood pressure and hypertension.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...