Property Summary

NCBI Gene PubMed Count 40
Grant Count 34
R01 Count 22
Funding $3,164,414.15
PubMed Score 137.10
PubTator Score 65.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.400 0.000
oligodendroglioma 1.200 0.000
osteosarcoma -1.912 0.000
group 3 medulloblastoma 1.600 0.001
cystic fibrosis -1.284 0.000
primitive neuroectodermal tumor 1.400 0.001
lung cancer 1.400 0.027
pediatric high grade glioma 1.200 0.000
atypical teratoid/rhabdoid tumor 1.400 0.003
pilocytic astrocytoma 1.300 0.000

 GWAS Trait (1)

Gene RIF (19)

PMID Text
26805734 TRIM24 regulate resistance to Gefitinib via Akt pathway in non-small cell lung cancer cells.
25846736 TRIM24 is overexpressed in human bladder cancer and facilitates bladder cancer growth and invasion, possibly through NF-kappaB and AKT signaling pathways.
25724180 our study shows that TRIM24 is overexpressed in human gastric cancer and accelerates cell growth as well as induce chemoresistance
25700357 functions as an oncogene in colorectal carcinogenesis
25065590 A role for TRIM24 in breast tumorigenesis through reprogramming of glucose metabolism in human mammary epithelial cells, further supporting TRIM24 as a viable therapeutic target in breast cancer.
24820418 Study shows that TRIM24 is destabilized by ATM-mediated phosphorylation of TRIM24S768 in response to DNA damage, which disrupts TRIM24-p53 interactions and promotes the degradation of TRIM24.
24469053 Our results suggest that TRIM24 might serve as a potential prognostic marker and therapeutic target for the management of malignant gliomas.
24409330 Overexpression of TRIM24 is associated with the onset and progress of human hepatocellular carcinoma.
23717505 Upon TRIM24 silencing, the proliferation of HNSCC cells was notably inhibited due to the induction of apoptosis.
22666376 TRIM24 plays an important role in NSCLC progression
More...

AA Sequence

MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKL      1 - 70
LPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHII     71 - 140
DNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSP    141 - 210
EAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEK    211 - 280
TKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVA    281 - 350
GLSKQLEHVMHFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL    351 - 420
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAP    421 - 490
VGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAF    491 - 560
LAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYDGKAFGSPMIDLSSPVGGSYNLPSLPDIDCS    561 - 630
STIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSS    631 - 700
SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQS    701 - 770
STSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC    771 - 840
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCER    841 - 910
LLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFN    911 - 980
EPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK    981 - 1050
//

Text Mined References (57)

PMID Year Title
26805734 2016 [Mechanism of TRIM24 to Regulate Resistance of Gefitinib in NSCLC cells].
25846736 2015 Clinical significance and biological roles of TRIM24 in human bladder carcinoma.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25724180 2015 TRIM24 is upregulated in human gastric cancer and promotes gastric cancer cell growth and chemoresistance.
25700357 2014 Knockdown of tripartite motif containing 24 by lentivirus suppresses cell growth and induces apoptosis in human colorectal cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25065590 2015 TRIM24 links glucose metabolism with transformation of human mammary epithelial cells.
24820418 2014 TRIM24 is a p53-induced E3-ubiquitin ligase that undergoes ATM-mediated phosphorylation and autodegradation during DNA damage.
More...