Property Summary

Ligand Count 26
NCBI Gene PubMed Count 49
PubMed Score 142.96
PubTator Score 65.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.100 4.4e-03
Astrocytoma, Pilocytic 1.400 1.5e-07
atypical teratoid/rhabdoid tumor 1.400 2.8e-03
cystic fibrosis -1.258 3.1e-05
glioblastoma 1.400 8.9e-07
group 3 medulloblastoma 1.500 1.3e-05
lung cancer 1.400 2.7e-02
oligodendroglioma 1.100 2.1e-12
osteosarcoma -1.912 1.1e-07
primitive neuroectodermal tumor 1.400 8.6e-04

 GWAS Trait (1)

Gene RIF (27)

AA Sequence

MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKL      1 - 70
LPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHII     71 - 140
DNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSP    141 - 210
EAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEK    211 - 280
TKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVA    281 - 350
GLSKQLEHVMHFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL    351 - 420
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAP    421 - 490
VGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAF    491 - 560
LAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYDGKAFGSPMIDLSSPVGGSYNLPSLPDIDCS    561 - 630
STIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSS    631 - 700
SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQS    701 - 770
STSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC    771 - 840
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCER    841 - 910
LLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFN    911 - 980
EPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK    981 - 1050
//

Text Mined References (67)

PMID Year Title