Property Summary

NCBI Gene PubMed Count 75
PubMed Score 77.34
PubTator Score 75.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.028 6.4e-05
adult high grade glioma 1.800 2.6e-04
Astrocytoma, Pilocytic 1.800 1.4e-07
cutaneous lupus erythematosus 2.100 5.1e-04
dermatomyositis 2.400 7.9e-03
Duchenne muscular dystrophy 1.066 3.8e-06
ependymoma 1.300 4.3e-04
glioblastoma 1.400 9.7e-05
group 4 medulloblastoma -1.700 3.9e-04
juvenile dermatomyositis 2.942 1.0e-19
lung cancer -2.000 6.2e-04
malignant mesothelioma 1.500 6.7e-06
medulloblastoma, large-cell -1.700 1.1e-04
Multiple myeloma 1.439 1.7e-03
Multiple Sclerosis 1.900 2.4e-03
non primary Sjogren syndrome sicca -1.400 1.8e-02
ovarian cancer -1.900 2.4e-03
pancreatic cancer 1.200 3.0e-03
primary pancreatic ductal adenocarcinoma 1.274 5.4e-03
psoriasis 1.200 1.9e-05
Rheumatoid arthritis 1.400 4.0e-02
tuberculosis and treatment for 6 months -1.100 6.4e-04

Gene RIF (53)

AA Sequence

MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYN      1 - 70
QPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVY     71 - 140
FAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTW    141 - 210
HPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQ    211 - 280
FPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW                                    281 - 318
//

Text Mined References (79)

PMID Year Title