Property Summary

NCBI Gene PubMed Count 69
PubMed Score 70.26
PubTator Score 75.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Influenza 142
Disease Target Count P-value
juvenile dermatomyositis 1189 8.96995030931431E-20
malignant mesothelioma 3163 6.56313939277513E-8
pilocytic astrocytoma 3086 1.41550729262037E-7
lung cancer 4473 1.90490776095239E-6
posterior fossa group A ependymoma 1511 3.70944965688902E-6
Duchenne muscular dystrophy 602 3.79390144678938E-6
primary Sjogren syndrome 789 4.29204393803646E-5
acute quadriplegic myopathy 1157 6.41607078944687E-5
medulloblastoma, large-cell 6234 1.06611576917748E-4
glioblastoma 5572 1.59457538744501E-4
cutaneous lupus erythematosus 1056 2.4852966460354E-4
adult high grade glioma 2148 2.55333215806769E-4
group 4 medulloblastoma 1875 3.85807233805925E-4
ovarian cancer 8492 4.11459109802389E-4
tuberculosis and treatment for 6 months 686 6.39779347708042E-4
dermatomyositis 967 0.00126850161199099
Multiple myeloma 1328 0.00165832488242503
Multiple Sclerosis 498 0.00240633087534822
pancreatic cancer 2300 0.00299266795370441
psoriasis 6685 0.00408758876566343
primary pancreatic ductal adenocarcinoma 1271 0.00535661010973335
Rheumatoid Arthritis 1171 0.0401758319583198

Expression

Synonym

Accession O15162 B2R8H8 B4DTE8 PL scramblase 1
Symbols MMTRA1B

Gene

PANTHER Protein Class (1)

PDB

1Y2A  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (50)

PMID Text
26679604 directed mutagenesis revealed the importance of c-Myc binding sites from -751 to -756 and -548 to -553 on the promoter of hPLSCR1in transcriptionally regulating the expression of hPLSCR1.
26642712 PLSCR1 positively regulates hepatic carcinoma cell proliferation and migration through interacting with midkine
26204401 The mechanisms of pH-induced functional activation of hPLSCR1 are described.
25365352 PLSCR1 mediates the antiviral activity and anticarcinogenesis against hepatitis B virus by regulating HBx stability.
25362260 Suggest role for PLSCR1 in negatively regulating trophoblast fusion rather than directly promoting fusion.
25229146 affinity of SCR for cholesterol-rich domains in membranes
24878522 This is the first report showing the transcriptional regulation of hPLSCR1 expression by Snail TF and its possible implications in cancer progression.
24648509 hPLSCR1 and PRD-hPLSCR2 showed Ca(2+)-dependent aggregation and scrambling activity
24356419 PLSCR1 interacted with ANG in the cell nucleus and regulated rRNA transcription.
24343571 The C-terminal transmembrane domain of human phospholipid scramblase 1 is essential for the protein flip-flop activity and Ca(2)-binding.
More...

AA Sequence

MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYN      1 - 70
QPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVY     71 - 140
FAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTW    141 - 210
HPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQ    211 - 280
FPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW                                    281 - 318
//

Text Mined References (73)

PMID Year Title
26679604 2016 Two c-Myc binding sites are crucial in upregulating the expression of human phospholipid scramblase 1 gene.
26642712 2015 Phospholipid Scramblase 1 Interacts with Midkine and Regulates Hepatic Cancer Cell Proliferation and Migration.
26204401 2015 Biochemical evidence for Ca2+-independent functional activation of hPLSCR1 at low pH.
25416956 2014 A proteome-scale map of the human interactome network.
25365352 2015 Interactome map reveals phospholipid scramblase 1 as a novel regulator of hepatitis B virus x protein.
25362260 2015 Phospholipid scramblase 1 (PLSCR1) in villous trophoblast of the human placenta.
25229146 2014 A cholesterol recognition motif in human phospholipid scramblase 1.
24878522 2014 Snail interacts with hPLSCR1 promoter and down regulates its expression in IMR-32.
24648509 2014 N-terminal proline-rich domain is required for scrambling activity of human phospholipid scramblases.
24356419 2013 Phospholipid scramblase 1 functionally interacts with angiogenin and regulates angiogenin-enhanced rRNA transcription.
More...