Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $443,059.34
PubMed Score 136.23
PubTator Score 105.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.200 0.002
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 1.500 0.004
tuberculosis and treatment for 6 months -2.100 0.000
pancreatic carcinoma 1.500 0.004
acute myeloid leukemia -1.700 0.022
ovarian cancer -1.500 0.000

Gene RIF (1)

PMID Text
8621431 The distinct localizations of rsec22 and rbet1 may reflect their participation in opposite directions of membrane flow between the endoplasmic reticulum and Golgi apparatus.

AA Sequence

MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQ      1 - 70
FDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR                           71 - 118
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...