Property Summary

NCBI Gene PubMed Count 180
Grant Count 270
R01 Count 169
Funding $20,281,654.76
PubMed Score 182.06
PubTator Score 187.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession O15151 Q2M2Y2 Q32SL2 Q6GS18 Q8IV83
Symbols HDMX
MDMX
MRP1

Gene

PDB

2MWY   3DAB   3MQR   2CR8   2N06   2N0U   2N0W   2N14   2VJE   2VJF   2VYR   3EQY   3FDO   3FE7   3FEA   3JZO   3JZP   3JZQ   3LBJ   3U15   4RXZ  

 GO Component (2)

Gene RIF (141)

PMID Text
26471763 MDM4 SNP34091 status to be associated with reduced risk of breast cancer, in particular in individuals carrying the MDM2 SNP309GG genotype, but not to be associated with either lung-, colon- or prostate cancer.
26416355 Authors show that the EMT phenotype in multiple cellular models and in clinical prostate and breast cancer samples is associated with a decrease in MDM2 and increase in MDMX expression.
26274820 MDM4 rs4245739 single nucleotide polymorphism contributes to small cell lung cancer risk and support the notion that gene 3'-UTR genetic variants, impacting miRNA-binding, might modify small cell lung cancer susceptibility.
26181202 These results identify Mdmx growth dependency in wt p53 expressing breast cancer across a range of subtypes. Based on our findings, we propose that Mdmx targeting is an attractive strategy for treating breast cancer harboring wt p53
26159518 CETSA was able to validate stapled peptide binding to Mdm2 and Mdm4.
26148237 The phosphate group of pTyr99 imposes extensive steric clashes with the C-terminus of p53 peptide and induces a significant lateral shift of the peptide ligand, decreasing the binding affinity of MDMX for p53.
26028311 MDM4 mutation identified in a glioma patient was associated with loss of the putative MDM4 target site. Therefore, let-7 binding to MDM4 is implicated in the DNA damage response
25961923 MDM4/HIPK2/p53 cytoplasmic assembly uncovers coordinated repression of molecules with anti-apoptotic activity during early DNA damage response.
25825738 Data indicate that both p53-binding protein oncoprotein MDM2 and MDMX protein bind to p53 through a hydrophobic pocket at the N-terminal domain, but the interactions appear to be regulated differently.
25809483 analysis of an MDM2 C-terminal deletion mutant reveals that the C-terminal residues of MDM2 are required for both MDM2 and MDMX interaction.
More...

AA Sequence

MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQE      1 - 70
QHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSA     71 - 140
EESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNY    141 - 210
TPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGK    211 - 280
NDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIP    281 - 350
EKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ    351 - 420
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA    421 - 490
//

Text Mined References (182)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26471763 2015 MDM4 SNP34091 (rs4245739) and its effect on breast-, colon-, lung-, and prostate cancer risk.
26416355 2015 Opposite regulation of MDM2 and MDMX expression in acquisition of mesenchymal phenotype in benign and cancer cells.
26274820 2015 A Regulatory MDM4 Genetic Variant Locating in the Binding Sequence of Multiple MicroRNAs Contributes to Susceptibility of Small Cell Lung Cancer.
26181202 2015 Targeting Mdmx to treat breast cancers with wild-type p53.
26159518 2015 Assessing the Efficacy of Mdm2/Mdm4-Inhibiting Stapled Peptides Using Cellular Thermal Shift Assays.
26148237 2016 Structural basis of how stress-induced MDMX phosphorylation activates p53.
26028311 2015 MDM4 regulation by the let-7 miRNA family in the DNA damage response of glioma cells.
25961923 2016 MDM4/HIPK2/p53 cytoplasmic assembly uncovers coordinated repression of molecules with anti-apoptotic activity during early DNA damage response.
25825738 2015 Autoinhibition of MDMX by intramolecular p53 mimicry.
More...