Property Summary

NCBI Gene PubMed Count 33
PubMed Score 14.69
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (8)

AA Sequence

MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTC      1 - 70
GTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKP     71 - 140
IRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCF    141 - 210
SASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLS    211 - 280
FGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGM    281 - 350
DGGMSIWDVKSLESALKDLKIK                                                    351 - 372
//

Text Mined References (34)

PMID Year Title