Property Summary

NCBI Gene PubMed Count 54
PubMed Score 22.08
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.049 1.6e-02
Alzheimer's disease -1.200 4.0e-02
Amyotrophic lateral sclerosis 1.066 6.4e-06
Breast cancer -1.100 5.7e-08
breast carcinoma -1.100 4.9e-25
glioblastoma -1.200 1.3e-02
group 4 medulloblastoma 1.800 2.5e-04
medulloblastoma, large-cell 1.400 2.4e-02
ovarian cancer -2.500 5.8e-09
Pick disease -1.300 4.7e-04
progressive supranuclear palsy -1.100 2.1e-02

Synonym

Accession O15131 B2RAI5 Q86X23
Symbols SRP6
IPOA6

Gene

PDB

4U2X  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (48)

AA Sequence

MASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDIS      1 - 70
STVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCT     71 - 140
LQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEI    141 - 210
LPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLS    211 - 280
DGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKE    281 - 350
SIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVAL    351 - 420
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEI    421 - 490
YQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL                            491 - 536
//

Text Mined References (59)

PMID Year Title