Property Summary

NCBI Gene PubMed Count 53
Grant Count 8
R01 Count 4
Funding $468,914.51
PubMed Score 7.28
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
group 4 medulloblastoma 1.800 0.000
glioblastoma -1.200 0.013
medulloblastoma, large-cell 1.400 0.024
Amyotrophic Lateral Sclerosis 1.066 0.000
aldosterone-producing adenoma -1.049 0.016
breast carcinoma -1.100 0.000
Alzheimer's disease -1.200 0.040
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.021
Breast cancer -1.500 0.000
ovarian cancer -2.500 0.000

Gene RIF (65)

PMID Text
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25121748 eVP24 recognizes a unique nonclassical nuclear localization signal binding site on KPNA5 that is necessary for efficient phosphoryated STAT1 nuclear transport.
24103892 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
22509482 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
21326825 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
21326825 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
20406804 Study identified the sequences KKKRR, KKKRK, and KKRKK as the optimal sequences for binding to this site for mouse importin-alpha2, human importin-alpha1, and human importin-alpha5, respectively.
20015032 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
20015032 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
19961612 HIV-1 IN interacts with importin alpha by the BiFC assay and amino acids 161-173 in IN are required for the interaction with importin alpha
More...

AA Sequence

MASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDIS      1 - 70
STVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCT     71 - 140
LQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEI    141 - 210
LPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLS    211 - 280
DGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKE    281 - 350
SIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVAL    351 - 420
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEI    421 - 490
YQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL                            491 - 536
//

Text Mined References (58)

PMID Year Title
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25121748 2014 Ebola virus VP24 targets a unique NLS binding site on karyopherin alpha 5 to selectively compete with nuclear import of phosphorylated STAT1.
22770219 2012 Acetylation-dependent regulation of Skp2 function.
22022502 2011 An interaction network predicted from public data as a discovery tool: application to the Hsp90 molecular chaperone machine.
21460395 2011 A genome-wide association study identifies a locus on chromosome 14q21 as a predictor of leukocyte telomere length and as a marker of susceptibility for bladder cancer.
21269460 2011 Initial characterization of the human central proteome.
20406804 2010 Probing the specificity of binding to the major nuclear localization sequence-binding site of importin-alpha using oriented peptide library screening.
17981117 2007 Plasmodium circumsporozoite protein promotes the development of the liver stages of the parasite.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...