Property Summary

NCBI Gene PubMed Count 19
Grant Count 24
R01 Count 15
Funding $2,398,858.59
PubMed Score 312.16
PubTator Score 67.10

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (5)

PMID Text
23333304 HIV-1 Vif upregulates the expression of neuropeptide FF-amide peptide precursor (NPFF) in Vif-expression T cells
21120930 reduction of NPFF release within the dorsal motor nucleus and ambiguus nucleus could serve as a possible cause of the impairment of cardiac vagal control in hypertensive patients
17854890 the findings from the early studies on the analgesic and morphine modulating activities suggested a role for NPFF in pain modulation--review
17224450 neuropeptide FF and micro-opioid receptor association could be a possible molecular basis for anti-opioid activity
16336216 expression of hNPFF2 receptor mRNA was up-regulated by neuropeptide FF

AA Sequence

MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFL      1 - 70
FQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK                                71 - 113
//

Text Mined References (21)

PMID Year Title
25538682 2014 RFamide Peptides in Early Vertebrate Development.
25161813 2014 The hypothalamic neuropeptide FF network is impaired in hypertensive patients.
21120930 2011 Vasopressin (VP) and neuropeptide FF (NPFF) systems in the normal and hypertensive human brainstem.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17854890 2008 Modulatory role of neuropeptide FF system in nociception and opiate analgesia.
17224450 2007 Physical association between neuropeptide FF and micro-opioid receptors as a possible molecular basis for anti-opioid activity.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
16336216 2006 Regulation of endogenous human NPFF2 receptor by neuropeptide FF in SK-N-MC neuroblastoma cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...