Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.16
PubTator Score 10.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
intraductal papillary-mucinous neoplasm (IPMN) 3290 2.3e-03
astrocytoma 1146 3.7e-03
lung cancer 4740 5.4e-03
glioblastoma 5792 3.1e-02
Disease Target Count Z-score Confidence
Bartter disease 13 3.626 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.700 3.7e-03
glioblastoma 1.200 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.3e-03
lung cancer -1.300 5.4e-03

Gene RIF (5)

AA Sequence

MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT      1 - 70
QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE     71 - 140
IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF    141 - 210
RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV    211 - 280
FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN                         281 - 329
//

Text Mined References (25)

PMID Year Title