Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 34.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
gastric cancer -1.100 0.003
pancreatic cancer -1.300 0.004
Multiple myeloma 1.234 0.012
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.800 0.005
ependymoma -1.800 0.004
oligodendroglioma -1.500 0.017
psoriasis -1.500 0.000
glioblastoma -2.400 0.000
osteosarcoma 3.653 0.000
group 4 medulloblastoma 1.700 0.024
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor -1.100 0.001
adrenocortical carcinoma 1.222 0.007
intraductal papillary-mucinous adenoma (... 1.700 0.007
intraductal papillary-mucinous carcinoma... 1.600 0.007
lung cancer 1.100 0.038
Parkinson's disease -1.400 0.045
Breast cancer 3.400 0.027
interstitial cystitis -1.100 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.600 0.000
non primary Sjogren syndrome sicca -1.100 0.025
pancreatic carcinoma -1.300 0.004
lung carcinoma 1.500 0.000
Pick disease -1.200 0.002
ovarian cancer 2.000 0.001
Gaucher disease type 1 -1.500 0.023
dermatomyositis 1.900 0.001

Gene RIF (2)

PMID Text
23653380 RNA interference-mediated downregulation of SCAMP1 resulted in a marked reduction in cell migration and invasion, but not proliferation in tumor cell lines.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEH      1 - 70
PAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVD     71 - 140
IPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAF    141 - 210
RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLV    211 - 280
MFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI                281 - 338
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23653380 2013 Inhibition of SCAMP1 suppresses cell migration and invasion in human pancreatic and gallbladder cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...