Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 34.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 1.222 7.1e-03
adult high grade glioma -1.800 3.7e-05
astrocytic glioma -1.800 4.6e-03
Astrocytoma, Pilocytic -1.600 2.4e-07
atypical teratoid / rhabdoid tumor -2.100 1.3e-08
Breast cancer 3.100 2.4e-02
dermatomyositis 1.900 8.4e-04
ependymoma -1.800 4.0e-03
gastric cancer -1.100 3.3e-03
Gaucher disease type 1 -1.500 2.3e-02
glioblastoma -1.800 1.4e-09
group 3 medulloblastoma -1.100 1.7e-02
interstitial cystitis -1.100 1.8e-04
intraductal papillary-mucinous adenoma (... 1.200 1.2e-02
intraductal papillary-mucinous carcinoma... 1.600 7.0e-03
lung cancer 1.100 3.8e-02
lung carcinoma 1.500 3.5e-28
malignant mesothelioma -1.600 1.0e-04
medulloblastoma, large-cell 1.200 7.4e-04
Multiple myeloma 1.073 2.8e-03
non primary Sjogren syndrome sicca -1.100 2.5e-02
oligodendroglioma -1.500 1.7e-02
osteosarcoma 3.653 1.9e-08
ovarian cancer -1.200 9.4e-04
pancreatic cancer -1.300 3.5e-03
pancreatic carcinoma -1.300 3.5e-03
Parkinson's disease -1.400 4.5e-02
Pick disease -1.200 1.9e-03
primitive neuroectodermal tumor -1.100 6.3e-04
psoriasis -1.200 2.5e-03

Gene RIF (2)

AA Sequence

MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEH      1 - 70
PAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVD     71 - 140
IPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAF    141 - 210
RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLV    211 - 280
MFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI                281 - 338
//

Text Mined References (30)

PMID Year Title