Property Summary

NCBI Gene PubMed Count 382
PubMed Score 734.46
PubTator Score 678.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 2.770 8.1e-06
Astrocytoma, Pilocytic 1.500 3.1e-04
cutaneous lupus erythematosus 1.100 1.6e-03
dermatomyositis 1.100 2.5e-02
ependymoma 1.600 1.0e-05
glioblastoma 1.600 7.7e-04
group 3 medulloblastoma 1.200 1.0e-02
inflammatory breast cancer 1.800 6.0e-05
interstitial cystitis 1.800 1.6e-03
lung cancer 1.100 2.2e-02
nasopharyngeal carcinoma 1.600 6.9e-03
oligodendroglioma 1.100 9.2e-05
osteosarcoma 1.978 9.2e-03
ovarian cancer 1.100 2.3e-07
pediatric high grade glioma 1.600 2.8e-04
urothelial carcinoma 2.200 3.6e-05

Protein-protein Interaction (3)

Gene RIF (369)

AA Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAP      1 - 70
LEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTR     71 - 140
KLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIK    141 - 210
EEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQIS    211 - 280
FRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPS    281 - 350
GEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG    351 - 420
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMM    421 - 490
IRPADF                                                                    491 - 496
//

Text Mined References (389)

PMID Year Title