Property Summary

NCBI Gene PubMed Count 338
Grant Count 201
R01 Count 124
Funding $13,111,672.19
PubMed Score 683.56
PubTator Score 678.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession O15123 A0AV38 A8K205 B7ZLM7 Q9NRR7 Q9P2Y7 ANG-2
Symbols ANG2
AGPT2

Gene

PANTHER Protein Class (1)

PDB

2GY7   1Z3S   1Z3U   4JZC   4ZFG  

Gene RIF (325)

PMID Text
26898800 We conclude that ScBsAbAgn-2/TSPO targeting of glioblastoma cell lines can be achieved in vitro and in vivo.
26858516 Early Angpt-2 levels quantified in 48 adult hemolytic uremic syndrome patients were predictive for a complicated clinical course
26776887 plasma levels correlate with the exacerbated state of bronchial asthma
26743170 miR-150 is a novel suppressor of Ang2 generation with a key role in resolving vascular injury and reducing mortality resulting from sepsis.
26666269 A novel role for endothelial cells in therapy resistance and identify endothelial cell/myeloid cell crosstalk is mediated by Ang-2 as a potential resistance mechanism.
26634521 our results suggest that angiopoietin-2 can be used as a diagnostic biomarker for colorectal cancer in clinical practice.
26562248 High(Ang-2/VEGF) serum levels could be exploited as a new valuable integral biomarker in NSCLC.
26489624 ANGPT1, ANGPT2, and VEGF are associated with development of acute graft-versus-host disease after allogeneic hematopoietic stem cell transplantation.
26456066 MicroRNA-30 mediates anti-inflammatory effects of shear stress and KLF2 via repression of Ang2.
26283334 Gingipains from the Porphyromonas gingivalis play roles in regulation of angiopoietin 1 and angiopoietin 2 in human aortic smooth muscle cells.
More...

AA Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAP      1 - 70
LEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTR     71 - 140
KLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIK    141 - 210
EEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQIS    211 - 280
FRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPS    281 - 350
GEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG    351 - 420
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMM    421 - 490
IRPADF                                                                    491 - 496
//

Text Mined References (345)

PMID Year Title
26898800 2016 A bispecific antibody (ScBsAbAgn-2/TSPO) target for Ang-2 and TSPO resulted in therapeutic effects against glioblastomas.
26858516 2015 Involvement of Angiopoietin-2 and Tie2 Receptor Phosphorylation in STEC-HUS Mediated by Escherichia coli O104:H4.
26776887 2016 Circulating angiopoietin-1 and -2 in patients with stable and exacerbated asthma.
26743170 2016 MicroRNA-150 Suppression of Angiopoetin-2 Generation and Signaling Is Crucial for Resolving Vascular Injury.
26666269 2016 Endothelial cell-derived angiopoietin-2 is a therapeutic target in treatment-naive and bevacizumab-resistant glioblastoma.
26634521 2015 Association between serum angiopoietin-2 concentration and clinicopathological parameters in patients with colorectal cancer.
26562248 2015 Combined Ang-2 and VEGF serum levels: holding hands as a new integral biomarker in non-small-cell lung cancers.
26489624 2015 Angiogenic factors are associated with development of acute graft-versus-host disease after allogeneic hematopoietic stem cell transplantation.
26456066 2015 MicroRNA-30 mediates anti-inflammatory effects of shear stress and KLF2 via repression of angiopoietin 2.
26283334 2015 Gingipains from the Periodontal Pathogen Porphyromonas gingivalis Play a Significant Role in Regulation of Angiopoietin 1 and Angiopoietin 2 in Human Aortic Smooth Muscle Cells.
More...