Property Summary

NCBI Gene PubMed Count 13
Grant Count 51
R01 Count 33
Funding $7,713,636.02
PubMed Score 1576.16
PubTator Score 142.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.142 0.005
malignant mesothelioma -1.200 0.000
cutaneous lupus erythematosus -1.300 0.002
glioblastoma 1.400 0.023
active Crohn's disease 1.559 0.005
ulcerative colitis 1.700 0.000
interstitial cystitis 1.300 0.000
pilocytic astrocytoma 1.200 0.000
nasopharyngeal carcinoma 1.100 0.001
lung adenocarcinoma 1.011 0.000
dermatomyositis 1.300 0.001

Gene RIF (8)

PMID Text
26494858 ABC294640 may reduce the proliferative capacity of castration-resistant prostate cancer cells through inhibition of both sphingosine kinase 2 and dihydroceramide desaturase.
23267130 Dihydroceramide desaturase 1 (DES) is a potential molecular target for regulating apoptotic resistance to photodynamic therapy
22628619 changes in lipid homeostasis and gene expression in Huh7 hepatocytes when the synthesis of ceramide is perturbed by knocking down serine pal mitoyltransferase subunits 1, 2, and 3 (SPTLC123) or dihydroceramide desaturase 1 (DEGS1)
22377532 a role of the sphingolipid pathway, dihydroceramides desaturase in particular, in confluence-induced growth arrest in neuroblastoma cells
21914808 overexpression of DEGS1 or DEGS2 attenuates the DHC accumulation and increased cell proliferation during hypoxia
20105137 oxidative stress leads to potent inhibition of dihydroceramide desaturase resulting in significant elevation in dihydroceramide levels in vivo
17283068 partial loss of DEGS-1 inhibited cell growth, with cell cycle arrest at G(0)/G(1). This was accompanied by a significant decrease in the amount of phosphorylated retinoblastoma protein
11937514 identification of sphingolipid delta 4-desaturase family

AA Sequence

MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVI      1 - 70
FGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGV     71 - 140
DVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLV    141 - 210
YMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIA    211 - 280
AEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE                               281 - 323
//

Text Mined References (18)

PMID Year Title
26494858 2015 The Sphingosine Kinase 2 Inhibitor ABC294640 Reduces the Growth of Prostate Cancer Cells and Results in Accumulation of Dihydroceramides In Vitro and In Vivo.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
23267130 2013 Dihydroceramide desaturase knockdown impacts sphingolipids and apoptosis after photodamage in human head and neck squamous carcinoma cells.
22628619 2012 Silencing of enzymes involved in ceramide biosynthesis causes distinct global alterations of lipid homeostasis and gene expression.
22377532 2012 Cell density-dependent reduction of dihydroceramide desaturase activity in neuroblastoma cells.
21914808 2011 Dihydroceramide-based response to hypoxia.
21269460 2011 Initial characterization of the human central proteome.
20105137 2010 Dihydroceramide desaturase activity is modulated by oxidative stress.
19647031 N-Myristoylation targets dihydroceramide Delta4-desaturase 1 to mitochondria: partial involvement in the apoptotic effect of myristic acid.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...