Property Summary

Ligand Count 1
NCBI Gene PubMed Count 14
PubMed Score 2224.68
PubTator Score 142.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.554 2.2e-03
active ulcerative colitis 1.413 6.4e-03
Astrocytoma, Pilocytic 1.200 5.0e-06
cutaneous lupus erythematosus -1.300 2.2e-03
dermatomyositis 1.300 5.6e-04
glioblastoma 1.400 2.3e-02
interstitial cystitis 1.300 1.9e-04
lung adenocarcinoma 1.011 3.5e-04
malignant mesothelioma -1.200 1.1e-05
Multiple myeloma 1.142 5.0e-03
nasopharyngeal carcinoma 1.100 5.9e-04

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVI      1 - 70
FGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGV     71 - 140
DVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLV    141 - 210
YMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIA    211 - 280
AEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE                               281 - 323
//

Text Mined References (19)

PMID Year Title