Property Summary

NCBI Gene PubMed Count 30
Grant Count 21
R01 Count 16
Funding $1,377,529.4
PubMed Score 87.06
PubTator Score 67.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (18)

PMID Text
24498038 Data show that missense mutation c.299G>A changes serine in the acyltransferase NHX4D motif of AGPAT2, and intronic c.493-1G>C mutation destroy a splicing site that leads to exon 4 skipping and deletion of whole AGPAT2 substrate binding domain.
24205284 the ability of LPAAT-beta to regulate mTOR function
23578572 miR-24 may play an important role in inhibiting osteosarcoma growth through suppression of LPAATbeta.
22902344 novel nonsense a missense mutations were found in two patients with congenital generalized lipodystrophy type 1.
22872237 Data suggest that AGPAT2 regulates adipogenesis through modulation of lipid metabolism/signal transduction, altering normal activation of phosphatidylinositol 3-kinase (PI3K)/protooncogene c-Akt and PPARgamma signaling in early stage of adipogenesis.
21873652 the role of AGPAT1 or AGPAT2 in liver lipogenesis is minimal and that accumulation of liver fat is primarily a consequence of insulin resistance
21176343 lpaat beta gene overexpression exists in both AML and CML patients. lpaat beta produced by AML cells probably plays an important role in abnormal proliferation and drug-resistance of AML cells.
21152068 Lysophosphatidic acid acyltransferase beta (LPAATbeta) promotes the tumor growth of human osteosarcoma
19278620 Study showed that the cellular level of lysophosphatidic acid was increased in AGPAT2 deficient cells.
19226263 We have demonstrated four novel mutations of the BSCL2 and AGPAT2 genes responsible for Berardinelli-Seip syndrome and Brunzell syndrome (AGPAT2-related syndrome).
More...

AA Sequence

MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSF      1 - 70
KYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFF     71 - 140
INRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIVPVVYSSFSSF    141 - 210
YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ      211 - 278
//

Text Mined References (31)

PMID Year Title
24498038 2014 Divergent metabolic phenotype between two sisters with congenital generalized lipodystrophy due to double AGPAT2 homozygous mutations. a clinical, genetic and in silico study.
24205284 2013 Lysophosphatidic acid acyltransferase beta regulates mTOR signaling.
23578572 2013 MicroRNA-24 inhibits osteosarcoma cell proliferation both in vitro and in vivo by targeting LPAAT?.
22902344 2012 Identification of a novel nonsense mutation and a missense substitution in the AGPAT2 gene causing congenital generalized lipodystrophy type 1.
22872237 2012 Alterations in lipid signaling underlie lipodystrophy secondary to AGPAT2 mutations.
21873652 2011 Human 1-acylglycerol-3-phosphate O-acyltransferase isoforms 1 and 2: biochemical characterization and inability to rescue hepatic steatosis in Agpat2(-/-) gene lipodystrophic mice.
21269460 2011 Initial characterization of the human central proteome.
21176343 2010 [Lysophosphatidic acid acyltransferase ? gene expression in newly diagnosed leukemia patients].
21152068 2010 Lysophosphatidic acid acyltransferase ? (LPAAT?) promotes the tumor growth of human osteosarcoma.
19278620 2009 Seipin deficiency alters fatty acid Delta9 desaturation and lipid droplet formation in Berardinelli-Seip congenital lipodystrophy.
More...