Property Summary

NCBI Gene PubMed Count 69
PubMed Score 253.99
PubTator Score 98.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.62141287241995E-22
lung adenocarcinoma 2714 1.83513007071025E-16
lung carcinoma 2844 1.49003389798413E-9
malignant mesothelioma 3163 2.46683344251995E-8
psoriasis 6685 6.29822138217858E-7
interstitial cystitis 2299 3.74928640396233E-6
lung cancer 4473 9.00764413254731E-6
cystic fibrosis 1670 2.90054177780301E-5
ovarian cancer 8492 6.76120278226868E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 9.64216535652309E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.03165343854386E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00113488095795509
osteosarcoma 7933 0.00205838968572393
colon cancer 1475 0.00256892608235288
invasive ductal carcinoma 2950 0.0194417306452856
inflammatory breast cancer 404 0.0242950920647577
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0
Disease Target Count
Ulnar-mammary syndrome 1

Expression

  Differential Expression (16)

Synonym

Accession O15119 Q8TB20 Q9UKF8 T-box protein 3
Symbols UMS
XHL
TBX3-ISO

Gene

PANTHER Protein Class (1)

PDB

1H6F  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

 GO Component (1)

 GWAS Trait (1)

Gene RIF (48)

PMID Text
25743805 Overexpression of Tbx3 is associated with pancreatic carcinoma.
25455105 TBX3 gene variants may contribute to indirect inguinal hernia as a rare risk factor by reducing TBX3 levels
25394776 this new molecular-grade based on the combination of TBX2 and TBX3 methylation is an excellent marker for predicting progression to muscle-invasive bladder cancer in patients with primary pTaG1/2 bladder cancer.
25371204 Data show that the down-regulation of T-box transcription factor TBX2 by transforming growth factor beta I (TGF-beta1) is mediated by T-box transcription factor TBX3.
25350852 Paracrine WNT signaling is stimulated by estrogen and progesterone, while autocrine WNT signaling is induced by the embryonic T-box transcription factor TBX3
25158279 An enhancement in TBX3 protein expression both in glomerular and tubular regions.
24675841 The pleiotropic effects of TBX3 mutations in humans and mice likely result from disrupting at least two molecular functions of this protein: transcriptional regulation and pre-mRNA splicing.
24386373 Polymorphisms in several genes involved in the Wnt signaling pathway were associated with hepatic fibrosis or inflammation risk in HCV-infected males.
24098938 TBX3 may play an important role as a reciprocal switch between substrate dependent cell proliferation and tumour invasion.
24025717 TBX3 plays a pivotal role in mediating the antiproliferative and promigratory role of TGF-beta1 in breast epithelial cells and skin keratinocytes.
More...

AA Sequence

MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVG      1 - 70
AAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRC     71 - 140
SGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLT    141 - 210
NNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIA    211 - 280
VTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFA    281 - 350
QASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE    351 - 420
RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAA    421 - 490
AHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTA    491 - 560
MASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHRHPFLN    561 - 630
LNTMRPRLRYSPYSIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLS    631 - 700
SSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP                               701 - 743
//

Text Mined References (74)

PMID Year Title
25743805 2015 Overexpression of Tbx3 predicts poor prognosis of patients with resectable pancreatic carcinoma.
25455105 2015 Genetic and functional analysis of the TBX3 gene promoter in indirect inguinal hernia.
25416956 2014 A proteome-scale map of the human interactome network.
25394776 2015 Stratification based on methylation of TBX2 and TBX3 into three molecular grades predicts progression in patients with pTa-bladder cancer.
25371204 2014 The anti-proliferative function of the TGF-?1 signaling pathway involves the repression of the oncogenic TBX2 by its homologue TBX3.
25350852 2014 Human breast progenitor cell numbers are regulated by WNT and TBX3.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25158279 2014 TBX3, a downstream target of TGF-?1, inhibits mesangial cell apoptosis.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24850809 2014 Genetic determinants of P wave duration and PR segment.
More...