Property Summary

NCBI Gene PubMed Count 77
PubMed Score 255.57
PubTator Score 98.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -1.400 8.8e-04
colon cancer 1.300 2.6e-03
cystic fibrosis 1.460 2.9e-05
interstitial cystitis -1.600 3.2e-04
intraductal papillary-mucinous adenoma (... -1.200 9.6e-05
intraductal papillary-mucinous carcinoma... -1.200 6.0e-04
intraductal papillary-mucinous neoplasm ... -1.400 1.1e-03
invasive ductal carcinoma 1.200 1.9e-02
lung adenocarcinoma -1.100 4.1e-15
lung cancer 2.000 9.0e-06
lung carcinoma -1.200 1.5e-09
malignant mesothelioma -4.300 2.5e-08
non-small cell lung carcinoma -1.100 1.6e-22
osteosarcoma 2.528 2.1e-03
ovarian cancer -1.300 6.8e-05
psoriasis -1.500 6.3e-07

 GO Component (1)

Gene RIF (55)

AA Sequence

MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVG      1 - 70
AAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRC     71 - 140
SGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLT    141 - 210
NNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIA    211 - 280
VTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFA    281 - 350
QASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE    351 - 420
RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAA    421 - 490
AHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTA    491 - 560
MASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHRHPFLN    561 - 630
LNTMRPRLRYSPYSIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLS    631 - 700
SSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP                               701 - 743
//

Text Mined References (82)

PMID Year Title