Property Summary

NCBI Gene PubMed Count 29
Grant Count 37
R01 Count 28
Funding $4,625,920.38
PubMed Score 102.20
PubTator Score 44.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
invasive ductal carcinoma 1.100 0.017

Gene RIF (7)

PMID Text
25872476 These results provide evidence that LSm1 binding to the DENV RNA 3' UTR positively regulates DENV RNA replication.
24035562 The results of this study provided further support for previous genetic findings reporting the association of an intronic SNP (rs16887244) in LSM1 and schizophrenia in a Chinese sample
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18218995 Results suggest that LSm-1/CaSm functions as an oncogene in the promotion of cellular transformation and cancer progression.
17001308 LSM1 is a breast cancer oncogene from the 8p11-12 amplicon.
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci
11953827 Lsm1 is deeply involved in prostate cancer progression through its down-regulation, independent of any gene mutation.

AA Sequence

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN      1 - 70
VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY            71 - 133
//

Text Mined References (31)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25872476 2015 LSm1 binds to the Dengue virus RNA 3' UTR and is a positive regulator of Dengue virus replication.
25416956 2014 A proteome-scale map of the human interactome network.
24035562 2013 Further evidence for the association between the LSM1 gene and schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
21788678 A sparse regulatory network of copy-number driven gene expression reveals putative breast cancer oncogenes.
20852261 2011 The human Pat1b protein: a novel mRNA deadenylation factor identified by a new immunoprecipitation technique.
More...