Property Summary

NCBI Gene PubMed Count 30
PubMed Score 106.03
PubTator Score 44.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
invasive ductal carcinoma 2951 1.7e-02
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 3.0
Disease Target Count Z-score Confidence
pancreatic cancer 2398 3.161 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
invasive ductal carcinoma 1.100 1.7e-02

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN      1 - 70
VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY            71 - 133
//

Text Mined References (32)

PMID Year Title