Property Summary

NCBI Gene PubMed Count 255
Grant Count 287
R01 Count 181
Funding $22,436,071.29
PubMed Score 201.10
PubTator Score 321.53

Knowledge Summary

Patent (13,787)

Expression

Synonym

Accession O15111 O14666 Q13132 Q5W0I4 Q92467 I-kappa-B kinase alpha
Symbols IKK1
IKKA
IKBKA
TCF16
NFKBIKA
IKK-alpha

Gene

PDB

3BRT  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (184)

PMID Text
26317791 IKKalpha is diversely expressed in keratinizing and non-keratinizing carcinomas in the same type of cancer.
26094020 results indicate that nuclear active IKK is a robust biomarker to predict cutaneous squamous cell carcinoma outcome, and suggest the possibility of targeting IKK activity as a future therapy for treating metastatic cutaneous squamous cell carcinomas
26075907 HIV-1 Tat induces phosphorylation of CHUK (IKKalpha) in CRT-MG human astroglioma cells
26031809 HIV-1 Tat induces phosphorylation of CHUK (IKKalpha) in CRT-MG human astroglioma cells
25900832 BRAF-induced tumorigenesis is IKKalpha-dependent but NF-kappaB-independent
25740981 Upon infection, the HCV 3'UTR redistributes DDX3X and IKK-alpha to speckle-like cytoplasmic structures shown to be stress granules.
25510414 TRIM22 could interact with IkappaB kinase (IKK)alpha but not IKKbeta and could increase the level and phosphorylation of IKKalpha through its really interesting new gene (RING) and spla-ryanodine receptor (SPRY) domains.
25482200 We also report that the extra-genomic effects elicited by both ligands, leading to recruitment of active Akt to chromatin, are essential for phosphorylation of serine 10 in histone H3 by IKKa
25187543 Authors show that activation of NF-kappaB by Kaposi's sarcoma-associated herpesvirus K15 protein involves the recruitment of NF-kappaB-inducing kinase (NIK) and IKK alpha/beta to result in the phosphorylation of p65/RelA on Ser536.
25096806 Suppression of PKK expression by RNA interference inhibits phosphorylation of IKKalpha and IKKbeta as well as activation of NF-kappaB in human cancer cell lines; thus, PKK regulates NF-kappaB activation by modulating activation of IKKalpha and IKKbeta.
More...

AA Sequence

MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNH      1 - 70
ANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKI     71 - 140
IHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTM    141 - 210
VFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLML    211 - 280
NWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTG    281 - 350
SQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI    351 - 420
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLD    421 - 490
LERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESL    491 - 560
EQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALS    561 - 630
NIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP    631 - 700
QDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE                             701 - 745
//

Text Mined References (265)

PMID Year Title
26859459 2016 Serine/Threonine Kinase MLK4 Determines Mesenchymal Identity in Glioma Stem Cells in an NF-?B-dependent Manner.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26317791 2015 Opposed expression of IKK?: loss in keratinizing carcinomas and gain in non-keratinizing carcinomas.
26094020 2015 Active nuclear IKK correlates with metastatic risk in cutaneous squamous cell carcinoma.
25900832 2015 BRAF-induced tumorigenesis is IKK?-dependent but NF-?B-independent.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25740981 2015 Dynamic Interaction of Stress Granules, DDX3X, and IKK-? Mediates Multiple Functions in Hepatitis C Virus Infection.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25510414 2015 TRIM22 can activate the noncanonical NF-?B pathway by affecting IKK?.
25482200 Nuclear receptor-induced transcription is driven by spatially and timely restricted waves of ROS. The role of Akt, IKK?, and DNA damage repair enzymes.
More...