Property Summary

NCBI Gene PubMed Count 257
PubMed Score 638.75
PubTator Score 329.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.142 1.3e-02
adult high grade glioma -1.200 2.4e-03
atypical teratoid / rhabdoid tumor -1.200 1.3e-02
lung carcinoma -1.100 8.8e-11
medulloblastoma, large-cell -1.400 1.2e-02
Multiple myeloma 1.186 2.1e-02
ovarian cancer 1.500 1.7e-03
subependymal giant cell astrocytoma -2.097 1.3e-02
tuberculosis -2.000 4.3e-05
ulcerative colitis -1.200 2.7e-06

Protein-protein Interaction (11)

Gene RIF (222)

AA Sequence

MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAK      1 - 70
GHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGA     71 - 140
PAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPP    141 - 210
YSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQ    211 - 280
EPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNP    281 - 350
DSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE    351 - 420
VIFNSR                                                                    421 - 426
//

Text Mined References (262)

PMID Year Title