Property Summary

NCBI Gene PubMed Count 229
Grant Count 230
R01 Count 149
Funding $24,909,986.26
PubMed Score 485.15
PubTator Score 329.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.186 0.021
atypical teratoid / rhabdoid tumor -1.200 0.013
medulloblastoma, large-cell -1.400 0.012
tuberculosis -2.000 0.000
active Crohn's disease -1.142 0.013
adult high grade glioma -1.200 0.002
subependymal giant cell astrocytoma -2.097 0.013
lung carcinoma -1.100 0.000
ulcerative colitis -1.200 0.000
ovarian cancer 1.500 0.002

Synonym

Accession O15105 B7Z773 K7EQ10 O14740 Q6DK23 MAD homolog 7
Symbols CRCS3
MADH7
MADH8

Gene

PANTHER Protein Class (1)

PDB

2LTY   2LTX   2DJY   2KXQ   2LTV   2LTW   2LTZ  

 GWAS Trait (1)

Gene RIF (195)

PMID Text
26759305 Results showed that SMAD7 was up-regulated in hepatocellular carcinoma tissues and was found to be the target of UPF1.
26651974 Data indicate that, in irritable bowel disease, high Smad7 contributes to sustain detrimental immune responses and knockdown of this molecule can help attenuate the ongoing mucosal inflammation in patients with such disorders
26608417 Suggest that greater tumor associated macrophage density, strong Hexim1 expression, strong SMAD2 expression, and mild SMAD7 expression play important roles in the progression of prostate adenocarcinoma.
26579801 Meta-analysis showed that for SMAD7 gene, rs4939827 and rs4464148 are risk factors for colorectal cancer (CRC) among Caucasians whereas rs12953717 could elevate the susceptibility to CRC in both Caucasians and Asians.
26445225 TGF-beta/Smad signalling pathway and VEGF-A participate in the pathogenesis of sarcoidosis.
26390174 MiR-185-3p and miR-324-3p can modulate NPC cell growth and apoptosis, at least partly through targeting SMAD7.
26303523 The decrease in miR-195 led to an increase in Smad7 expression and corresponding up-regulation of p65 and the AP-1 (activator protein 1) pathway, which might explain the mechanism of steroid resistance in ulcerative colitis patients
26278416 The expression of Smad7 increased.
26071245 Increased miR-16 expression promotes liver fibrosis through downregulation of HGF and Smad7 in hepatitis C patients.
26055326 Overexpression of Smad7 in human HaCaT keratinocyte cells and mouse skin tissues elevated EGF receptor (EGFR) activity by impairing ligand-induced ubiquitination and degradation of activated receptor, which is induced by the E3 ubiquitin ligase c-Cbl.
More...

AA Sequence

MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAK      1 - 70
GHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGA     71 - 140
PAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPP    141 - 210
YSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQ    211 - 280
EPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNP    281 - 350
DSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE    351 - 420
VIFNSR                                                                    421 - 426
//

Text Mined References (234)

PMID Year Title
26759305 2016 The human RNA surveillance factor UPF1 regulates tumorigenesis by targeting Smad7 in hepatocellular carcinoma.
26651974 2016 Smad7 and its Potential as Therapeutic Target in Inflammatory Bowel Diseases.
26608417 2016 Role of tumor-associated macrophages in the Hexim1 and TGF?/SMAD pathway, and their influence on progression of prostatic adenocarcinoma.
26579801 2015 Correlation Between CASC8, SMAD7 Polymorphisms and the Susceptibility to Colorectal Cancer: An Updated Meta-Analysis Based on GWAS Results.
26445225 2015 Immunoexpression of TGF-?/Smad and VEGF-A proteins in serum and BAL fluid of sarcoidosis patients.
26390174 2015 MiR-185-3p and miR-324-3p Predict Radiosensitivity of Nasopharyngeal Carcinoma and Modulate Cancer Cell Growth and Apoptosis by Targeting SMAD7.
26303523 2015 miR-195 plays a role in steroid resistance of ulcerative colitis by targeting Smad7.
26278416 2015 Effects of Astragaloside IV Against the TGF-?1-Induced Epithelial-to-Mesenchymal Transition in Peritoneal Mesothelial Cells by Promoting Smad 7 Expression.
26071245 2015 Increased miR-16 expression induced by hepatitis C virus infection promotes liver fibrosis through downregulation of hepatocyte growth factor and Smad7.
26055326 2015 Smad7 Modulates Epidermal Growth Factor Receptor Turnover through Sequestration of c-Cbl.
More...