Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $1,192,918
PubMed Score 66.34
PubTator Score 23.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.345 0.000

 GO Function (1)

Gene RIF (5)

PMID Text
25953853 This study presents the crystal structure of human MRPP3, which features a remarkably distorted and hence non-productive active site that authors propose will switch to a fully productive state only upon association with MRPP1, MRPP2 and pre-tRNA substrate.
24763589 using a genome-wide association study, found that posttranscriptional modification of functionally important sites in mitochondrial transfer RNAs (tRNAs) is under strong genetic control, largely driven by a missense mutation in MRPP3
23755257 Inhibition of mitochondrial RNase P by beta-amyloid is an unspecific effect and is not mediated by beta-amyloid interaction with SDR5C1.
19624571 Haplotypes in KIAA0391 and PSMA6 genes is a genetic link for myocardial infarction and coronary artery disease.
19624571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTFYLFGIRSFPKLWKSPYLGLGPGHSYVSLFLADRCGIRNQQRLFSLKTMSPQNTKATNLIAKARYLRK      1 - 70
DEGSNKQVYSVPHFFLAGAAKERSQMNSQTEDHALAPVRNTIQLPTQPLNSEEWDKLKEDLKENTGKTSF     71 - 140
ESWIISQMAGCHSSIDVAKSLLAWVAAKNNGIVSYDLLVKYLYLCVFHMQTSEVIDVFEIMKARYKTLEP    141 - 210
RGYSLLIRGLIHSDRWREALLLLEDIKKVITPSKKNYNDCIQGALLHQDVNTAWNLYQELLGHDIVPMLE    211 - 280
TLKAFFDFGKDIKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSG    281 - 350
CGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKV    351 - 420
RESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSG    421 - 490
NHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPY    491 - 560
DEDLVERCSCEVPTKWLCLHQKT                                                   561 - 583
//

Text Mined References (18)

PMID Year Title
25953853 2015 Structure of the nuclease subunit of human mitochondrial RNase P.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24763589 2014 High-resolution genomic analysis of human mitochondrial RNA sequence variation.
23755257 2013 The amyloid-?-SDR5C1(ABAD) interaction does not mediate a specific inhibition of mitochondrial RNase P.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
19624571 2009 Haplotypes encompassing the KIAA0391 and PSMA6 gene cluster confer a genetic link for myocardial infarction and coronary artery disease.
18984158 2008 RNase P without RNA: identification and functional reconstitution of the human mitochondrial tRNA processing enzyme.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
More...