Property Summary

NCBI Gene PubMed Count 13
PubMed Score 69.47
PubTator Score 23.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 1.22517503539448E-4

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 1.2e-04
osteosarcoma -1.345 1.2e-05

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MTFYLFGIRSFPKLWKSPYLGLGPGHSYVSLFLADRCGIRNQQRLFSLKTMSPQNTKATNLIAKARYLRK      1 - 70
DEGSNKQVYSVPHFFLAGAAKERSQMNSQTEDHALAPVRNTIQLPTQPLNSEEWDKLKEDLKENTGKTSF     71 - 140
ESWIISQMAGCHSSIDVAKSLLAWVAAKNNGIVSYDLLVKYLYLCVFHMQTSEVIDVFEIMKARYKTLEP    141 - 210
RGYSLLIRGLIHSDRWREALLLLEDIKKVITPSKKNYNDCIQGALLHQDVNTAWNLYQELLGHDIVPMLE    211 - 280
TLKAFFDFGKDIKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSG    281 - 350
CGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKV    351 - 420
RESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSG    421 - 490
NHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPY    491 - 560
DEDLVERCSCEVPTKWLCLHQKT                                                   561 - 583
//

Text Mined References (20)

PMID Year Title