Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.30
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.600 0.015
posterior fossa group A ependymoma -2.100 0.000
oligodendroglioma -1.700 0.000
glioblastoma -3.300 0.000
group 4 medulloblastoma 2.400 0.000
atypical teratoid / rhabdoid tumor -2.200 0.020
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -3.300 0.000
subependymal giant cell astrocytoma -3.963 0.003
lung carcinoma 1.500 0.000
ovarian cancer -1.500 0.000
pituitary cancer -4.500 0.000
psoriasis -1.600 0.000

Synonym

Accession O15090 A2RU18
Symbols

Gene

Gene RIF (2)

PMID Text
18187620 Knockdown of zinc finger protein 536 (ZNF536) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17065439 ZFP536 promotes the late phase of oligodendrocyte differentiation.

AA Sequence

MEEASLCLGVSSAEPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKPPASLEEKAHV      1 - 70
PMSGQPMGSQMALLANQLGREVDTSLNGRVDLQQFLNGQNLGIMSQMSDIEDDARKNRKYPCPLCGKRFR     71 - 140
FNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTHKLGNLGKGRGRVREENRLLHELEERAILRD    141 - 210
KQLKGSLLQPRPDLKPPPHAQQAPLAACTLALQANHSVPDVAHPVPSPKPASVQEDAVAPAAGFRCTFCK    211 - 280
GKFKKREELDRHIRILHKPYKCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVC    281 - 350
GQVFSQAWFLKGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPSDPEVPVPMGGMSQ    351 - 420
EAHANLYSRYLSCLQSGFMTPDKAGLSEPSQLYGKGELPMKEKEALGKLLSPISSMAHGVPEGDKHSLLG    421 - 490
CLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSKEHPLQRNHEDTLANAGVLFD    491 - 560
KEKREYVLVGADGSKQKMPADLVHSTKVGSQRDLPSKLDPLESSRDFLSHGLNQTLEYNLQGPGNMKEKP    561 - 630
TECPDCGRVFRTYHQVVVHSRVHKRDRKGEEDGLHVGLDERRGSGSDQESQSVSRSTTPGSSNVTEESGV    631 - 700
GGGLSQTGSAQEDSPHPSSPSSSDIGEEAGRSAGVQQPALLRDRSLGSAMKDCPYCGKTFRTSHHLKVHL    701 - 770
RIHTGEKPYKCPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPNQDHKDEMSSKASLFIRPDILRG    771 - 840
AFKGLPGIDFRGGPASQQWTSGVLSSGDHSGQATGMSSEVPSDALKGTDLPSKSTHFSEIGRAYQSIVSN    841 - 910
GVNFQGSLQAFMDSFVLSSLKKEKDMKDKALADPPSMKVHGVDGGEEKPSGKSSQRKSEKSQYEPLDLSV    911 - 980
RPDAASLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALHLQANHLGKAKRKDNTIGVTVNCKDQAREASK    981 - 1050
MALLPSLQSNKDLGLSNMISSLDSASEKMAQGQLKETLGEQKSGAWTGHVDPAFCNFPSDFYKQFGVYPG   1051 - 1120
MVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMM   1121 - 1190
TKPLSALSKDSSSDGGDSLQPTGTSQPVQGLVSPLSQAPEKQWHSQGLLQAQDPLAGLPKPERGPQSLDK   1191 - 1260
PMNMLSVLRAYSSDGLAAFNGLASSTANSGCIKRPDLCGK                                 1261 - 1300
//

Text Mined References (15)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19398580 2009 ZNF536, a novel zinc finger protein specifically expressed in the brain, negatively regulates neuron differentiation by repressing retinoic acid-induced gene transcription.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17065439 2006 Functional genomic analysis of oligodendrocyte differentiation.
More...