Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.64
PubTator Score 40.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15084 B4DES5 Q1WWL4 Q29RW6 Q3B857 Q6ULS0 Q6ZT57 PP6-ARS-A
Symbols PITK
PPP1R65

Gene

Gene RIF (5)

PMID Text
27026398 findings suggest that BRCA1 is a novel modulator of PP6 signalling via its interaction with ANKRD28.
25902538 hnRNP K and hnRNP L may serve as A1CF-like cofactors in AID-mediated class switch recombination and somatic hypermutation
19118547 ANKRD28, a novel binding partner of DOCK180, promotes cell migration by regulating focal adhesion formation.
17023142 CaMKII and GSK3 mediate regulation of PITK.
16564677 These findings provide a putative mechanism by which transcriptional activity of hnRNP K can be discretely controlled through the regulation of PP1 activity.

AA Sequence

MAFLKLRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAK      1 - 70
DSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAG     71 - 140
RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPL    141 - 210
HAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAA    211 - 280
ASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYG    281 - 350
HELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLEC    351 - 420
LNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEY    421 - 490
LLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYH    491 - 560
GHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHS    561 - 630
ECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEE    631 - 700
CVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHET    701 - 770
CVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQ    771 - 840
LLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLIL    841 - 910
EKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL    911 - 980
ATMMPVSSSSPLSSLTFNAINRYTNTSKTVSFEALPIMRNEPSSYCSFNNIGGEQEYLYTDVDELNDSDS    981 - 1050
ETY                                                                      1051 - 1053
//

Text Mined References (23)

PMID Year Title
27026398 2016 BRCA1 affects protein phosphatase 6 signalling through its interaction with ANKRD28.
25902538 2015 Identification of DNA cleavage- and recombination-specific hnRNP cofactors for activation-induced cytidine deaminase.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21187329 2010 Protein phosphatase 6 regulates mitotic spindle formation by controlling the T-loop phosphorylation state of Aurora A bound to its activator TPX2.
19458477 Regulation of focal adhesion and cell migration by ANKRD28-DOCK180 interaction.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19118547 2009 Ankyrin repeat domain 28 (ANKRD28), a novel binding partner of DOCK180, promotes cell migration by regulating focal adhesion formation.
More...