Property Summary

NCBI Gene PubMed Count 19
Grant Count 25
R01 Count 12
Funding $1,612,758.56
PubMed Score 39.06
PubTator Score 10.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytoma -3.600 0.001
ependymoma -3.300 0.016
oligodendroglioma -2.800 0.000
glioblastoma -3.800 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -2.200 0.015
adult high grade glioma -3.300 0.000
pilocytic astrocytoma -3.000 0.000
lung carcinoma 1.500 0.000
Pick disease -2.000 0.019
ovarian cancer -1.700 0.000
psoriasis 1.900 0.000

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12923177 In vitro results indicate that ERC2/CAST, an active zone-specific isoform, interacts with all of the known isoforms of liprin-alpha and that liprin-alpha1 associates with both ERC2 and ERC1b

AA Sequence

MYGSARTITNLEGSPSRSPRLPRSPRLGHRRTSSGGGGGTGKTLSMENIQSLNAAYATSGPMYLSDHEGV      1 - 70
ASTTYPKGTMTLGRATNRAVYGGRVTAMGSSPNIASAGLSHTDVLSYTDQHGGLTGSSHHHHHQVPSMLR     71 - 140
QVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQ    141 - 210
MRVSHEENQHLQLTIQALQDELRTQRDLNHLLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLL    211 - 280
RKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKE    281 - 350
KENIHLREELHRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNTEDREEEIK    351 - 420
QIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTAKEQRAAILQT    421 - 490
EVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDK    491 - 560
QLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVN    561 - 630
ALQAELTEKESSLIDLKEHASSLASAGLKRDSKLKSLEIAIEQKKEECSKLEAQLKKAHNIEDDSRMNPE    631 - 700
FADQIKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKH    701 - 770
NQQLEKKKNAQLLEEVRRREDSMADNSQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLANL    771 - 840
RIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMK    841 - 910
LMADNYDDDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA                           911 - 957
//

Text Mined References (19)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21057379 2011 Case-case genome-wide association analysis shows markers differentially associated with schizophrenia and bipolar disorder and implicates calcium channel genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
15728193 2005 Molecular dissection of the photoreceptor ribbon synapse: physical interaction of Bassoon and RIBEYE is essential for the assembly of the ribbon complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...