Property Summary

NCBI Gene PubMed Count 19
PubMed Score 39.06
PubTator Score 10.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 4.7665457248129E-39
lung carcinoma 2844 6.49005559301955E-37
oligodendroglioma 2849 2.97826429962347E-22
ovarian cancer 8492 3.38429495275367E-11
pilocytic astrocytoma 3086 1.10928277241271E-8
atypical teratoid / rhabdoid tumor 4369 5.57427275442101E-8
medulloblastoma 1524 5.48522824267236E-6
glioblastoma 5572 9.66930320458291E-6
adult high grade glioma 2148 1.61127266308443E-5
medulloblastoma, large-cell 6234 5.23087682064228E-5
malignant mesothelioma 3163 2.17612382041732E-4
astrocytoma 1493 0.00126456660983557
primitive neuroectodermal tumor 3031 0.0150981207400913
ependymoma 2514 0.0160433633953005
Pick disease 1893 0.0193245943962073
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 1.0

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytoma -3.600 0.001
ependymoma -3.300 0.016
oligodendroglioma -2.800 0.000
glioblastoma -3.800 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -2.200 0.015
adult high grade glioma -3.300 0.000
pilocytic astrocytoma -3.000 0.000
lung carcinoma 1.500 0.000
Pick disease -2.000 0.019
ovarian cancer -1.700 0.000
psoriasis 1.900 0.000

Synonym

Accession O15083 Q2T9F6 Q86TK4
Symbols CAST
CAST1
ELKSL
Spc110
SPBC110

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12923177 In vitro results indicate that ERC2/CAST, an active zone-specific isoform, interacts with all of the known isoforms of liprin-alpha and that liprin-alpha1 associates with both ERC2 and ERC1b

AA Sequence

MYGSARTITNLEGSPSRSPRLPRSPRLGHRRTSSGGGGGTGKTLSMENIQSLNAAYATSGPMYLSDHEGV      1 - 70
ASTTYPKGTMTLGRATNRAVYGGRVTAMGSSPNIASAGLSHTDVLSYTDQHGGLTGSSHHHHHQVPSMLR     71 - 140
QVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQ    141 - 210
MRVSHEENQHLQLTIQALQDELRTQRDLNHLLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLL    211 - 280
RKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKE    281 - 350
KENIHLREELHRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNTEDREEEIK    351 - 420
QIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTAKEQRAAILQT    421 - 490
EVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDK    491 - 560
QLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVN    561 - 630
ALQAELTEKESSLIDLKEHASSLASAGLKRDSKLKSLEIAIEQKKEECSKLEAQLKKAHNIEDDSRMNPE    631 - 700
FADQIKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKH    701 - 770
NQQLEKKKNAQLLEEVRRREDSMADNSQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLANL    771 - 840
RIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMK    841 - 910
LMADNYDDDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA                           911 - 957
//

Text Mined References (19)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21057379 2011 Case-case genome-wide association analysis shows markers differentially associated with schizophrenia and bipolar disorder and implicates calcium channel genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
15728193 2005 Molecular dissection of the photoreceptor ribbon synapse: physical interaction of Bassoon and RIBEYE is essential for the assembly of the ribbon complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...