Property Summary

NCBI Gene PubMed Count 19
PubMed Score 40.70
PubTator Score 10.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.300 1.6e-05
astrocytic glioma -2.300 1.1e-03
Astrocytoma, Pilocytic -3.000 9.3e-09
atypical teratoid / rhabdoid tumor -4.400 5.6e-08
ependymoma -3.300 1.6e-02
glioblastoma -3.000 2.0e-08
group 4 medulloblastoma -1.600 5.0e-03
lung carcinoma 1.500 6.5e-37
malignant mesothelioma -1.300 2.2e-04
medulloblastoma, large-cell -3.300 5.2e-05
oligodendroglioma -2.700 5.4e-03
ovarian cancer -1.700 3.4e-11
Pick disease -2.000 1.9e-02
primitive neuroectodermal tumor -2.200 1.5e-02
psoriasis 1.900 4.8e-39

Gene RIF (4)

AA Sequence

MYGSARTITNLEGSPSRSPRLPRSPRLGHRRTSSGGGGGTGKTLSMENIQSLNAAYATSGPMYLSDHEGV      1 - 70
ASTTYPKGTMTLGRATNRAVYGGRVTAMGSSPNIASAGLSHTDVLSYTDQHGGLTGSSHHHHHQVPSMLR     71 - 140
QVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQ    141 - 210
MRVSHEENQHLQLTIQALQDELRTQRDLNHLLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLL    211 - 280
RKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLPSKSLEDDNERTRRMAEAESQVSHLEVILDQKE    281 - 350
KENIHLREELHRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKANGVLNTEDREEEIK    351 - 420
QIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTAKEQRAAILQT    421 - 490
EVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDK    491 - 560
QLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVN    561 - 630
ALQAELTEKESSLIDLKEHASSLASAGLKRDSKLKSLEIAIEQKKEECSKLEAQLKKAHNIEDDSRMNPE    631 - 700
FADQIKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKH    701 - 770
NQQLEKKKNAQLLEEVRRREDSMADNSQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLANL    771 - 840
RIERRKQLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMK    841 - 910
LMADNYDDDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQDDEEGIWA                           911 - 957
//

Text Mined References (19)

PMID Year Title