Property Summary

NCBI Gene PubMed Count 12
PubMed Score 57.42
PubTator Score 24.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.400 1.2e-06
astrocytoma -1.100 3.5e-19
atypical teratoid / rhabdoid tumor -2.900 8.8e-11
ependymoma -1.300 9.4e-03
glioblastoma -2.000 1.6e-09
group 3 medulloblastoma -2.100 5.5e-05
malignant mesothelioma -1.800 1.0e-06
medulloblastoma, large-cell -3.200 1.2e-05
oligodendroglioma -1.200 4.3e-16
osteosarcoma 1.006 5.0e-03
primitive neuroectodermal tumor -2.300 2.3e-05

 GO Function (1)

Gene RIF (4)

AA Sequence

MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPP      1 - 70
TPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARK     71 - 140
EIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLT    141 - 210
RSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSS    211 - 280
FGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPE    281 - 350
LDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSY    351 - 420
WSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSLSQPSPSPAGG    421 - 490
GSQL                                                                      491 - 494
//

Text Mined References (13)

PMID Year Title