Property Summary

NCBI Gene PubMed Count 10
Grant Count 15
Funding $6,589,491.45
PubMed Score 54.21
PubTator Score 24.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
ependymoma -1.900 0.000
astrocytoma -1.100 0.000
glioblastoma -2.400 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.006 0.005
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -2.300 0.000
adult high grade glioma -2.400 0.000

 GO Function (1)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12896979 syntaphilin is an inhibitor of both SNARE-based fusion and dynamin-mediated endocytosis

AA Sequence

MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPP      1 - 70
TPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARK     71 - 140
EIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLT    141 - 210
RSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSS    211 - 280
FGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPE    281 - 350
LDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSY    351 - 420
WSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSLSQPSPSPAGG    421 - 490
GSQL                                                                      491 - 494
//

Text Mined References (11)

PMID Year Title
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459722 2004 Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons.
12896979 2003 Syntaphilin binds to dynamin-1 and inhibits dynamin-dependent endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10707983 2000 Syntaphilin: a syntaxin-1 clamp that controls SNARE assembly.
More...