Property Summary

Ligand Count 2
NCBI Gene PubMed Count 72
PubMed Score 129.51
PubTator Score 61.03

Knowledge Summary

Patent (15,082)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160
Disease Target Count P-value
lung carcinoma 2843 6.8e-12
ovarian cancer 8520 1.7e-11
malignant mesothelioma 3232 1.7e-08
juvenile dermatomyositis 1187 5.4e-08
Astrocytoma, Pilocytic 3081 5.8e-08
Duchenne muscular dystrophy 601 3.0e-07
limb girdle muscular dystrophy 2A 213 3.2e-06
colon cancer 1478 6.1e-06
acute quadriplegic myopathy 1158 2.2e-05
glioblastoma 5792 3.6e-05
primary Sjogren syndrome 735 5.6e-05
Amyotrophic lateral sclerosis 451 6.6e-05
psoriasis 6694 9.6e-05
invasive ductal carcinoma 2951 2.2e-04
cystic fibrosis 1696 2.5e-04
atypical teratoid / rhabdoid tumor 5112 6.6e-04
medulloblastoma 720 7.0e-04
breast carcinoma 1638 1.1e-03
fascioscapulohumeral muscular dystrophy 100 1.1e-03
adult high grade glioma 3801 1.3e-03
lung cancer 4740 1.5e-03
Atopic dermatitis 952 1.8e-03
pituitary cancer 1972 3.3e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 3.7e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 5.6e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 7.0e-03
Becker muscular dystrophy 191 7.4e-03
Parkinson's disease 392 8.7e-03
ductal carcinoma in situ 1745 8.9e-03
subependymal giant cell astrocytoma 2287 9.8e-03
interstitial cystitis 2312 1.0e-02
Down syndrome 499 1.1e-02
Pick disease 1894 1.5e-02
oligodendroglioma 2850 1.9e-02
medulloblastoma, large-cell 6241 1.9e-02
diabetes mellitus 1728 1.9e-02
astrocytic glioma 2597 2.9e-02
ependymoma 4679 4.1e-02
intraductal papillary-mucinous neoplasm (IPMN) 3291 4.6e-02
primitive neuroectodermal tumor 3035 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Endometrial cancer 311 0.0 0.6
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Lissencephaly 69 4.296 2.1
Cancer 2499 3.744 1.9

Expression

  Differential Expression (41)

Disease log2 FC p
Breast cancer -1.500 2.2e-02
acute quadriplegic myopathy 1.207 2.2e-05
adult high grade glioma -1.600 1.3e-03
Amyotrophic lateral sclerosis 1.216 6.6e-05
astrocytic glioma -1.200 2.9e-02
Astrocytoma, Pilocytic -3.600 5.8e-08
Atopic dermatitis -2.100 1.8e-03
atypical teratoid / rhabdoid tumor -3.100 6.6e-04
autosomal dominant Emery-Dreifuss muscul... 2.061 7.0e-03
Becker muscular dystrophy 2.109 7.4e-03
breast carcinoma -1.200 1.1e-03
colon cancer -2.200 6.1e-06
cystic fibrosis -2.000 2.5e-04
diabetes mellitus -1.200 1.9e-02
Down syndrome -1.100 1.1e-02
Duchenne muscular dystrophy 1.707 3.0e-07
ductal carcinoma in situ -1.600 8.9e-03
ependymoma 2.300 4.1e-02
fascioscapulohumeral muscular dystrophy 1.299 1.1e-03
glioblastoma -2.300 3.6e-05
interstitial cystitis 1.600 1.0e-02
intraductal papillary-mucinous adenoma (... -1.600 3.7e-03
intraductal papillary-mucinous carcinoma... -1.600 5.6e-03
intraductal papillary-mucinous neoplasm ... -1.500 4.6e-02
invasive ductal carcinoma -2.272 2.2e-04
juvenile dermatomyositis 2.200 5.4e-08
limb girdle muscular dystrophy 2A 2.639 3.2e-06
lung cancer -1.900 1.5e-03
lung carcinoma 1.800 6.8e-12
malignant mesothelioma -3.500 1.7e-08
medulloblastoma -1.600 7.0e-04
medulloblastoma, large-cell -2.800 1.9e-02
oligodendroglioma -1.800 1.9e-02
ovarian cancer -2.300 1.7e-11
Parkinson's disease -1.500 8.7e-03
Pick disease -1.500 1.5e-02
pituitary cancer -2.400 3.3e-03
primary Sjogren syndrome 1.500 5.6e-05
primitive neuroectodermal tumor -1.300 4.7e-02
psoriasis -1.700 9.6e-05
subependymal giant cell astrocytoma 3.170 9.8e-03

Gene RIF (42)

AA Sequence

MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFK      1 - 70
GIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKL     71 - 140
EYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTA    141 - 210
HSFEQVLTDITDAIKLDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVK    211 - 280
STSYTKIASSSRRSTTKSPGPSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHG    281 - 350
GSSTSLASTKVCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI    351 - 420
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASG    421 - 490
MLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIA    491 - 560
ETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLV    561 - 630
DVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRR    631 - 700
RNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF                                  701 - 740
//

Text Mined References (76)

PMID Year Title