Property Summary

NCBI Gene PubMed Count 58
Grant Count 62
R01 Count 25
Funding $4,208,821.76
PubMed Score 113.95
PubTator Score 61.03

Knowledge Summary

Patent (15,082)

Expression

  Differential Expression (41)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
astrocytic glioma 2.400 0.012
ependymoma 2.300 0.041
oligodendroglioma -2.300 0.000
psoriasis -1.700 0.000
glioblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma -1.800 0.001
medulloblastoma, large-cell -3.000 0.005
primitive neuroectodermal tumor -1.300 0.047
Duchenne muscular dystrophy 3.564 0.000
Amyotrophic Lateral Sclerosis 3.475 0.000
acute quadriplegic myopathy 3.556 0.000
limb girdle muscular dystrophy 2A 2.639 0.000
Becker muscular dystrophy 2.109 0.007
autosomal dominant Emery-Dreifuss muscul... 2.061 0.007
fascioscapulohumeral muscular dystrophy 1.299 0.001
juvenile dermatomyositis 2.200 0.000
Atopic dermatitis -2.100 0.002
intraductal papillary-mucinous adenoma (... -3.200 0.001
intraductal papillary-mucinous carcinoma... -3.300 0.001
intraductal papillary-mucinous neoplasm ... -3.100 0.015
lung cancer -2.400 0.000
colon cancer -3.200 0.000
Parkinson's disease -1.500 0.009
breast carcinoma -1.500 0.000
diabetes mellitus -1.200 0.019
interstitial cystitis 1.600 0.010
cystic fibrosis -2.100 0.000
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -3.900 0.000
primary Sjogren syndrome 1.600 0.000
subependymal giant cell astrocytoma 3.170 0.010
Breast cancer -1.600 0.026
invasive ductal carcinoma -2.700 0.000
lung carcinoma 1.800 0.000
Pick disease -1.500 0.015
ductal carcinoma in situ -1.600 0.009
ovarian cancer -2.300 0.000
pituitary cancer -2.800 0.000
Down syndrome -1.100 0.011

Synonym

Accession O15075 B7Z3E9 Q5VZY8 Q5VZZ0 Q5VZZ1
Symbols CL1
DCLK
CLICK1
DCDC3A
DCAMKL1

Gene

PDB

1MFW   1MG4   1UF0   5JZJ   5JZN  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (28)

PMID Text
26764906 DCLK1 is essential for the invasive and metastatic properties of pancreatic cancer stem cells.
26468984 DCLK1 controls these complex cellular signaling pathways to regulate hepatocellular carcinoma growth, and may be used as a prognostic biomarker.
26447334 Data suggest that doublecortin and CaM kinase-like 1 protein short-transcripts (DCLK1-S) may represent an important target for preventing/inhibiting colon-cancers, and for eliminating colon-cancer-stem-cells (CSCs).
25948779 results provide new insights into the molecular mechanism of the hepatitis B/C-virus induced liver inflammation and tumorigenesis via DCLK1-controlled networks
25723399 Doublecortin-like kinase 1 is elevated serologically in pancreatic ductal adenocarcinoma and widely expressed on circulating tumor cells.
25631749 the higher expression level of DCLK1 in patients undergoing CRT can propose it as a more relevant candidate among CSC markers comparing to Lgr5 for colorectal cancer patients.
25605241 Data indicate that doublecortin-like kinase 1 (DCLK1) is overexpressed and has a unique methylation signature in renal clear cell carcinoma (RCC).
25283374 Increased expression of DCLK1 was observed in the epithelium, stroma and plasma of patients with Barrett's esophagus and esophageal adenocarcinoma.
24880079 XMD8-92 treatment results in inhibition of DCLK1 and downstream oncogenic pathways.
24626093 RNA interference-mediated silencing of DCLK1 triggers apoptotic cell death of colon cancer cells in vitro and in vivo.
More...

AA Sequence

MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFK      1 - 70
GIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKL     71 - 140
EYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTA    141 - 210
HSFEQVLTDITDAIKLDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVK    211 - 280
STSYTKIASSSRRSTTKSPGPSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHG    281 - 350
GSSTSLASTKVCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI    351 - 420
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASG    421 - 490
MLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIA    491 - 560
ETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLV    561 - 630
DVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRR    631 - 700
RNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF                                  701 - 740
//

Text Mined References (62)

PMID Year Title
26764906 2016 Dominant Expression of DCLK1 in Human Pancreatic Cancer Stem Cells Accelerates Tumor Invasion and Metastasis.
26468984 2015 Plasma DCLK1 is a marker of hepatocellular carcinoma (HCC): Targeting DCLK1 prevents HCC tumor xenograft growth via a microRNA-dependent mechanism.
26447334 2015 Epigenetic changes and alternate promoter usage by human colon cancers for expressing DCLK1-isoforms: Clinical Implications.
25948779 2015 Inflammatory and oncogenic roles of a tumor stem cell marker doublecortin-like kinase (DCLK1) in virus-induced chronic liver diseases.
25723399 2015 Doublecortin-like kinase 1 is elevated serologically in pancreatic ductal adenocarcinoma and widely expressed on circulating tumor cells.
25631749 2015 Upregulation of circulating cancer stem cell marker, DCLK1 but not Lgr5, in chemoradiotherapy-treated colorectal cancer patients.
25605241 2015 DCLK1 is a broadly dysregulated target against epithelial-mesenchymal transition, focal adhesion, and stemness in clear cell renal carcinoma.
25283374 2015 DCLK1 is detectable in plasma of patients with Barrett's esophagus and esophageal adenocarcinoma.
24880079 2014 XMD8-92 inhibits pancreatic tumor xenograft growth via a DCLK1-dependent mechanism.
24626093 2014 Curcumin promotes autophagic survival of a subset of colon cancer stem cells, which are ablated by DCLK1-siRNA.
More...