Property Summary

NCBI Gene PubMed Count 26
PubMed Score 3.20
PubTator Score 5.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (5)

PMID Text
25863161 Data indicate that ADAMTS2 and 3 cleave the amino-propeptide of fibrillar collagens and regulate blood vessels homeostasis and lymphangiogenesis. [review]
23333304 HIV-1 Vif upregulates the expression of ADAM metallopeptidase with thrombospondin type 1 motif 3 protein (ADAMTS3) in Vif-expression T cells
22205175 ADAMTS-2, -3, and -13 expression, but not that of ADAMTS-14, are increased in plaques causing AMI compared those associated with stable angina.
15708897 Observational study of gene-disease association. (HuGE Navigator)
11831030 extracellular matrix degrading enzyme

AA Sequence

MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSA      1 - 70
RDVSSNPEQLFFNITAFGKDFHLRLKPNTQLVAPGAVVEWHETSLVPGNITDPINNHQPGSATYRIRRTE     71 - 140
PLQTNCAYVGDIVDIPGTSVAISNCDGLAGMIKSDNEEYFIEPLERGKQMEEEKGRIHVVYKRSAVEQAP    141 - 210
IDMSKDFHYRESDLEGLDDLGTVYGNIHQQLNETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNY    211 - 280
LLTLMNIVNEIYHDESLGVHINVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHH    281 - 350
DHAIFLTRQDFGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETA    351 - 420
MGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFDHDWPKLPELPGINYSMDEQCRFDFGVGY    421 - 490
KMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHCMWKNANQQKQDGNWGSWTKF    491 - 560
GSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLCNTEECQKHFEDFRAQQCQQRNSHFEYQNTK    561 - 630
HHWLPYEHPDPKKRCHLYCQSKETGDVAYMKQLVHDGTHCSYKDPYSICVRGECVKVGCDKEIGSNKVED    631 - 700
KCGVCGGDNSHCRTVKGTFTRTPRKLGYLKMFDIPPGARHVLIQEDEASPHILAIKNQATGHYILNGKGE    701 - 770
EAKSRTFIDLGVEWDYNIEDDIESLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPTINSNNVI    771 - 840
QEELDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCNIQECTHPLWV    841 - 910
AEEWEHCTKTCGSSGYQLRTVRCLQPLLDGTNRSVHSKYCMGDRPESRRPCNRVPCPAQWKTGPWSECSV    911 - 980
TCGEGTEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPCLGDKSIFCQMEVLARYCSIPGYNKLCCESC    981 - 1050
SKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRP   1051 - 1120
NSKPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGK   1121 - 1190
IIDNRRPTRSSTLER                                                          1191 - 1205
//

Text Mined References (28)

PMID Year Title
26622631 2015 Effect of insulin on the mRNA expression of procollagen N-proteinases in chondrosarcoma OUMS-27 cells.
26232334 2015 Induction of human ADAMTS-2 gene expression by IL-1? is mediated by a multiple crosstalk of MEK/JNK and PI3K pathways in osteoblast like cells.
25863161 The procollagen N-proteinases ADAMTS2, 3 and 14 in pathophysiology.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25261644 The effects of hypericin on ADAMTS and p53 gene expression in MCF-7 breast cancer cells.
24752352 2014 IL-6 upregulates a disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS-2) in human osteosarcoma cells mediated by JNK pathway.
24552833 2014 CCBE1 enhances lymphangiogenesis via A disintegrin and metalloprotease with thrombospondin motifs-3-mediated vascular endothelial growth factor-C activation.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22205175 2012 Expression of ADAMTS-2, -3, -13, and -14 in culprit coronary lesions in patients with acute myocardial infarction or stable angina.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15708897 2005 Genetic association analysis of the IGFBP7, ADAMTS3, and IL8 genes as the potential osteoarthritis susceptibility that maps to chromosome 4q.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11831030 2001 [ADAMTS family--new extracellular matrix degrading enzyme].
11812023 2001 Metalloproteases and inhibitors in arthritic diseases.
11741898 2002 Cloning and characterization of ADAMTS-14, a novel ADAMTS displaying high homology with ADAMTS-2 and ADAMTS-3.
11408482 2001 Procollagen II amino propeptide processing by ADAMTS-3. Insights on dermatosparaxis.
11167130 2001 ADAMTS: a novel family of extracellular matrix proteases.
10464288 1999 ADAM-TS5, ADAM-TS6, and ADAM-TS7, novel members of a new family of zinc metalloproteases. General features and genomic distribution of the ADAM-TS family.
10094461 1999 ADAMTS: a novel family of proteases with an ADAM protease domain and thrombospondin 1 repeats.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.