Property Summary

NCBI Gene PubMed Count 35
PubMed Score 12.36
PubTator Score 15.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 4.8e-04
astrocytic glioma -1.100 1.8e-02
Astrocytoma, Pilocytic -1.200 2.0e-03
atypical teratoid / rhabdoid tumor -2.100 2.2e-07
ependymoma -1.400 2.7e-02
glioblastoma -1.300 8.0e-07
group 3 medulloblastoma -1.200 5.1e-03
intraductal papillary-mucinous carcinoma... 1.200 8.3e-03
lung carcinoma 1.800 1.2e-19
malignant mesothelioma 3.300 5.5e-08
medulloblastoma, large-cell -2.200 2.7e-05
osteosarcoma 2.880 6.0e-08
ovarian cancer 1.600 2.7e-08
psoriasis -1.500 1.4e-04

Gene RIF (8)

AA Sequence

MFDCWRFILCKRPGSNSYSSPQRPNEAKKEETDHQIDVSDVIRLVQDTPEATAMATDEIMHQDIVPLCAA      1 - 70
DIQDQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRD     71 - 140
KWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGYIDKS    141 - 210
QLTEDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKDK    211 - 280
AKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQC    281 - 350
LQLRHFEQGFREVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIG    351 - 420
NKHYAVDSIRPKCQELRHLCDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQD    421 - 490
GAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAAR    491 - 560
QTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGEEEESLAI    561 - 630
LRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEIYHFHNRIFLREL    631 - 700
ENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQR    701 - 770
ITKYQLLLKEMLKYSRNCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWT    771 - 840
DHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAK    841 - 910
KFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGN    911 - 980
SRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGL    981 - 1050
GPKKLVPGKYTVVADHEKGGPDALRVRSGDVVELVQEGDEGLWYVRDPTTGKEGWVPASSLSVRLGPSGS   1051 - 1120
AQCLSSSGKAHVPRAHP                                                        1121 - 1137
//

Text Mined References (37)

PMID Year Title