Property Summary

NCBI Gene PubMed Count 29
Grant Count 1
R01 Count 1
Funding $60,682
PubMed Score 20.05
PubTator Score 17.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Barrett's esophagus 1.200 0.015
esophageal adenocarcinoma 1.700 0.018
osteosarcoma 1.551 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.000
adult high grade glioma -1.300 0.000
ovarian cancer 1.100 0.001

Synonym

Accession O15066 B2RMP4 B4DSR5 E1P5M5
Symbols FLA8
HH0048
KLP-11

Gene

 Grant Application (1)

PDB

3B6U  

Gene RIF (9)

PMID Text
25588831 These data suggest that GLI interactions with KIF3A-KIF3B-KAP3 complexes are essential for proper GLI transcriptional activity.
24368420 Results suggest that KIF3B expression was upregulated in HCC tumor tissues and proliferating HCC cells, and an increasd KIF3B expression was associated with poor overall survival.
21871436 KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney alpha-intercalated cells.
19940036 Interaction with KIF3B alters CLC-5 cell surface expression, chloride current, and alters albumin endocytosis. Interaction with KIF3B facilitates microtubular transport and endocytosis of CLC-5-containing vesicles away from cell surface.
19339549 Data indicate that p0071 and Ect2 are transported via distinct motors and identify a novel pathway implicating KIF3 in the regulation of actin organization during cytokinesis
18957512 Rip11/FIP5-kinesin-II complex plays a key role in the routing of internalized receptors through the perinuclear recycling endosomes.
17008358 kinesin-2 is a linker between polycystin-2(PC2) and fibrocystin and mediates the regulation of PC2 channel function by fibrocystin
16298999 Interaction of KIF3A/3B with KAP3 may be important for the proper progression of mitosis.
15345558 both motor domains of KIF3A/B coordinate for processive motility and move at different speeds

AA Sequence

MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQF      1 - 70
ELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLV     71 - 140
RASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNE    141 - 210
HSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVIS    211 - 280
ALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDP    281 - 350
KDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEK    351 - 420
LEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQQK    421 - 490
ILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQE    491 - 560
EHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIMNRAFFDEEEDHWKLHPITRLENQQMMKRPV    561 - 630
SAVGYKRPLSQHARMSMMIRPEARYRAENIVLLELDMPSRTTRDYEGPAIAPKVQAALDAALQDEDEIQV    631 - 700
DASSFESTANKKSKARPKSGRKSGSSSSSSGTPASQLYPQSRGLVPK                           701 - 747
//

Text Mined References (34)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25588831 2015 The heterotrimeric kinesin-2 complex interacts with and regulates GLI protein function.
24368420 2014 Suppression of KIF3B expression inhibits human hepatocellular carcinoma proliferation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21871436 2011 Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B).
19946888 2010 Defining the membrane proteome of NK cells.
19940036 2010 CLC-5 and KIF3B interact to facilitate CLC-5 plasma membrane expression, endocytosis, and microtubular transport: relevance to pathophysiology of Dent's disease.
More...