Property Summary

NCBI Gene PubMed Count 27
Grant Count 212
R01 Count 91
Funding $20,751,708.51
PubMed Score 94.86
PubTator Score 3151.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession O15061 A7E2Y2 Q2TBJ4 Q5NJJ9 Q8TE61 Q8TE62
Symbols DMN
SYN

Gene

Gene RIF (20)

PMID Text
25447537 alpha-Synemin localizes to the M-band of the sarcomere through interaction with the M10 region of titin
23594359 Immunohistochemistry of synemin in reactive astrocytes and Rosenthal fibers in two patients with Alexander disease. There was an abundance of GFAP-positive Rosenthal fibers and widespread reactive gliosis in the white matter and subpial regions.
22337773 synemin positively regulates glioblastoma cell proliferation by helping sequester PP2A away from Akt, thereby favoring Akt activation.
21144834 Synemin knock-down did not influence the cytoskeleton expression and organization of human Chang liver cells
20573469 Desmuslin expression is required for the maintenance of vascular smooth muscle phenotype. Decreased desmuslin expression may affect differentiation of VSMCs and ultimately contribute to the development of varicose veins.
20543860 SYNM could represent a novel putative breast tumor suppressor gene that is prone to epigenetic silencing. SYNM promoter methylation may become a useful predictive biomarker to stratify breast cancer patients' risk for tumor relapse.
20199207 The differences in human syncoilin and beta-synemin mRNA ratios between Duchenne muscular dystrophy and normal muscles were not statistically significant
19853601 The LIM domain protein zyxin was identified as an interaction partner for human synemin.
18342854 Results suggest human alpha-synemin plays an essential role in linking the heteropolymeric intermediate filament to adherens-type junctions, such as the costameres within mammalian striated muscle cells, via its interaction with talin.
18084875 results revealed that synemin was modulated nearly in all human human hepatocellular carcinoma cases
More...

AA Sequence

MLSWRLQTGPEKAELQELNARLYDYVCRVRELERENLLLEEELRGRRGREGLWAEGQARCAEEARSLRQQ      1 - 70
LDELSWATALAEGERDALRRELRELQRLDAEERAARGRLDAELGAQQRELQEALGARAALEALLGRLQAE     71 - 140
RRGLDAAHERDVRELRARAASLTMHFRARATGPAAPPPRLREVHDSYALLVAESWRETVQLYEDEVRELE    141 - 210
EALRRGQESRLQAEEETRLCAQEAEALRREALGLEQLRARLEDALLRMREEYGIQAEERQRAIDCLEDEK    211 - 280
ATLTLAMADWLRDYQDLLQVKTGLSLEVATYRALLEGESNPEIVIWAEHVENMPSEFRNKSYHYTDSLLQ    281 - 350
RENERNLFSRQKAPLASFNHSSALYSNLSGHRGSQTGTSIGGDARRGFLGSGYSSSATTQQENSYGKAVS    351 - 420
SQTNVRTFSPTYGLLRNTEAQVKTFPDRPKAGDTREVPVYIGEDSTIARESYRDRRDKVAAGASESTRSN    421 - 490
ERTVILGKKTEVKATREQERNRPETIRTKPEEKMFDSKEKASEERNLRWEELTKLDKEARQRESQQMKEK    491 - 560
AKEKDSPKEKSVREREVPISLEVSQDRRAEVSPKGLQTPVKDAGGGTGREAEARELRFRLGTSDATGSLQ    561 - 630
GDSMTETVAENIVTSILKQFTQSPETEASADSFPDTKVTYVDRKELPGERKTKTEIVVESKLTEDVDVSD    631 - 700
EAGLDYLLSKDIKEVGLKGKSAEQMIGDIINLGLKGREGRAKVVNVEIVEEPVSYVSGEKPEEFSVPFKV    701 - 770
EEVEDVSPGPWGLVKEEEGYGESDVTFSVNQHRRTKQPQENTTHVEEVTEAGDSEGEQSYFVSTPDEHPG    771 - 840
GHDRDDGSVYGQIHIEEESTIRYSWQDEIVQGTRRRTQKDGAVGEKVVKPLDVPAPSLEGDLGSTHWKEQ    841 - 910
ARSGEFHAEPTVIEKEIKIPHEFHTSMKGISSKEPRQQLVEVIGQLEETLPERMREELSALTREGQGGPG    911 - 980
SVSVDVKKVQGAGGSSVTLVAEVNVSQTVDADRLDLEELSKDEASEMEKAVESVVRESLSRQRSPAPGSP    981 - 1050
DEEGGAEAPAAGIRFRRWATRELYIPSGESEVAGGASHSSGQRTPQGPVSATVEVSSPTGFAQSQVLEDV   1051 - 1120
SQAARHIKLGPSEVWRTERMSYEGPTAEVVEVSAGGDLSQAASPTGASRSVRHVTLGPGQSPLSREVIFL   1121 - 1190
GPAPACPEAWGSPEPGPAESSADMDGSGRHSTFGCRQFHAEKEIIFQGPISAAGKVGDYFATEESVGTQT   1191 - 1260
SVRQLQLGPKEGFSGQIQFTAPLSDKVELGVIGDSVHMEGLPGSSTSIRHISIGPQRHQTTQQIVYHGLV   1261 - 1330
PQLGESGDSESTVHGEGSADVHQATHSHTSGRQTVMTEKSTFQSVVSESPQEDSAGDTSGAEMTSGVSRS   1331 - 1400
FRHIRLGPTETETSEHIAIRGPVSRTFVLAGSADSPELGKLADSSRTLRHIAPGPKETSFTFQMDVSNVE   1401 - 1470
AIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRS   1471 - 1540
VISDEKKVALLYLDNEEEENDGHWF                                                1541 - 1565
//

Text Mined References (33)

PMID Year Title
25447537 2014 ?-Synemin localizes to the M-band of the sarcomere through interaction with the M10 region of titin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23594359 2014 Synemin is expressed in reactive astrocytes and Rosenthal fibers in Alexander disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22337773 2012 Synemin promotes AKT-dependent glioblastoma cell proliferation by antagonizing PP2A.
21144834 2011 Synemin down-regulation in human hepatocellular carcinoma does not destabilize cytoskeletons in vivo.
20573469 2010 Desmuslin gene knockdown causes altered expression of phenotype markers and differentiation of saphenous vein smooth muscle cells.
20543860 2010 Intermediate filament dynamics and breast cancer: aberrant promoter methylation of the Synemin gene is associated with early tumor relapse.
20199207 2010 Dysbindin, syncoilin, and beta-synemin mRNA levels in dystrophic muscles.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...