Property Summary

NCBI Gene PubMed Count 28
PubMed Score 92.61
PubTator Score 3151.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.900 3.4e-02
Breast cancer -5.000 6.6e-23
breast carcinoma -2.800 5.8e-37
colon cancer -1.100 4.5e-02
ductal carcinoma in situ -1.700 1.5e-02
group 3 medulloblastoma -1.600 1.7e-04
intraductal papillary-mucinous adenoma (... -1.800 1.3e-04
intraductal papillary-mucinous carcinoma... -1.300 7.6e-03
invasive ductal carcinoma -3.400 3.1e-03
lung adenocarcinoma -1.500 1.5e-08
lung cancer -2.400 7.9e-04
malignant mesothelioma 3.000 1.4e-08
medulloblastoma, large-cell -2.800 5.0e-07
non-small cell lung cancer -1.480 3.7e-14
ovarian cancer 1.400 4.1e-05
posterior fossa group B ependymoma 1.200 1.4e-06
primitive neuroectodermal tumor -1.500 7.9e-03
psoriasis -1.900 2.1e-06
subependymal giant cell astrocytoma 1.883 3.3e-03

Gene RIF (21)

AA Sequence

MLSWRLQTGPEKAELQELNARLYDYVCRVRELERENLLLEEELRGRRGREGLWAEGQARCAEEARSLRQQ      1 - 70
LDELSWATALAEGERDALRRELRELQRLDAEERAARGRLDAELGAQQRELQEALGARAALEALLGRLQAE     71 - 140
RRGLDAAHERDVRELRARAASLTMHFRARATGPAAPPPRLREVHDSYALLVAESWRETVQLYEDEVRELE    141 - 210
EALRRGQESRLQAEEETRLCAQEAEALRREALGLEQLRARLEDALLRMREEYGIQAEERQRAIDCLEDEK    211 - 280
ATLTLAMADWLRDYQDLLQVKTGLSLEVATYRALLEGESNPEIVIWAEHVENMPSEFRNKSYHYTDSLLQ    281 - 350
RENERNLFSRQKAPLASFNHSSALYSNLSGHRGSQTGTSIGGDARRGFLGSGYSSSATTQQENSYGKAVS    351 - 420
SQTNVRTFSPTYGLLRNTEAQVKTFPDRPKAGDTREVPVYIGEDSTIARESYRDRRDKVAAGASESTRSN    421 - 490
ERTVILGKKTEVKATREQERNRPETIRTKPEEKMFDSKEKASEERNLRWEELTKLDKEARQRESQQMKEK    491 - 560
AKEKDSPKEKSVREREVPISLEVSQDRRAEVSPKGLQTPVKDAGGGTGREAEARELRFRLGTSDATGSLQ    561 - 630
GDSMTETVAENIVTSILKQFTQSPETEASADSFPDTKVTYVDRKELPGERKTKTEIVVESKLTEDVDVSD    631 - 700
EAGLDYLLSKDIKEVGLKGKSAEQMIGDIINLGLKGREGRAKVVNVEIVEEPVSYVSGEKPEEFSVPFKV    701 - 770
EEVEDVSPGPWGLVKEEEGYGESDVTFSVNQHRRTKQPQENTTHVEEVTEAGDSEGEQSYFVSTPDEHPG    771 - 840
GHDRDDGSVYGQIHIEEESTIRYSWQDEIVQGTRRRTQKDGAVGEKVVKPLDVPAPSLEGDLGSTHWKEQ    841 - 910
ARSGEFHAEPTVIEKEIKIPHEFHTSMKGISSKEPRQQLVEVIGQLEETLPERMREELSALTREGQGGPG    911 - 980
SVSVDVKKVQGAGGSSVTLVAEVNVSQTVDADRLDLEELSKDEASEMEKAVESVVRESLSRQRSPAPGSP    981 - 1050
DEEGGAEAPAAGIRFRRWATRELYIPSGESEVAGGASHSSGQRTPQGPVSATVEVSSPTGFAQSQVLEDV   1051 - 1120
SQAARHIKLGPSEVWRTERMSYEGPTAEVVEVSAGGDLSQAASPTGASRSVRHVTLGPGQSPLSREVIFL   1121 - 1190
GPAPACPEAWGSPEPGPAESSADMDGSGRHSTFGCRQFHAEKEIIFQGPISAAGKVGDYFATEESVGTQT   1191 - 1260
SVRQLQLGPKEGFSGQIQFTAPLSDKVELGVIGDSVHMEGLPGSSTSIRHISIGPQRHQTTQQIVYHGLV   1261 - 1330
PQLGESGDSESTVHGEGSADVHQATHSHTSGRQTVMTEKSTFQSVVSESPQEDSAGDTSGAEMTSGVSRS   1331 - 1400
FRHIRLGPTETETSEHIAIRGPVSRTFVLAGSADSPELGKLADSSRTLRHIAPGPKETSFTFQMDVSNVE   1401 - 1470
AIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRS   1471 - 1540
VISDEKKVALLYLDNEEEENDGHWF                                                1541 - 1565
//

Text Mined References (34)

PMID Year Title