Property Summary

NCBI Gene PubMed Count 25
Grant Count 12
R01 Count 11
Funding $757,339.99
PubMed Score 16.34
PubTator Score 15.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -3.100 0.008
ependymoma -3.300 0.016
oligodendroglioma -2.100 0.042
psoriasis -1.400 0.003
glioblastoma multiforme -1.500 0.000
osteosarcoma 1.175 0.000
sonic hedgehog group medulloblastoma -3.100 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.600 0.006
tuberculosis -1.700 0.000
non-small cell lung cancer 1.235 0.000
lung cancer 1.300 0.001
Breast cancer 3.300 0.022
adult high grade glioma -1.300 0.019
atypical teratoid/rhabdoid tumor -1.300 0.005
subependymal giant cell astrocytoma -2.302 0.037
lung adenocarcinoma 1.107 0.000
lung carcinoma 1.100 0.000
Pick disease -1.500 0.044
gastric carcinoma 1.200 0.021
ovarian cancer 2.500 0.000
pituitary cancer -1.700 0.000

 IMPC Term (1)

Gene RIF (9)

PMID Text
25605973 Synaptojanin 2 is a druggable mediator of metastasis and the gene is overexpressed and amplified in breast cancer.
24077433 The genetic interactions associated with ILVatrophy rate in this study may be mapping variants inSYNJ2andPI4KAthat interact to decrease synthesisof PIP.
23076136 Src-mediated phosphorylation of SYNJ2 contributes to invadopodia formation.
22213687 Single nucleotide polymorphisms in SYNJ2 are associated with personality disorders.
22045296 SYNJ2 is a novel gene in which variation is potentially associated with cognitive abilities.
21555518 SYNJ2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
16102578 Identification of inactivating mutations in the JAK1, SYNJ2, and CLPTM1 genes in prostate cancer cells
15548694 contributes to the role of Rac1 in cell invasion and migration by regulating the formation of invadopodia and lamellipodia
14562116 Since Syn 2 is a phosphatidylinositol 4,5-biphosphatase involved in cell growth and rearrangement of actin filaments, the increased Syn 2 expression may correlate with the hairy cell leukemia etiology or the characteristic morphologic alterations.

AA Sequence

MALSKGLRLLGRLGAEGDCSVLLEARGRDDCLLFEAGTVATLAPEEKEVIKGQYGKLTDAYGCLGELRLK      1 - 70
SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALKKILSSGVFYFSWPNDGSRF     71 - 140
DLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDWLLKIICGVVTIRTVYASHKQAKACLVSRVS    141 - 210
CERTGTRFHTRGVNDDGHVSNFVETEQMIYMDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLRLHRGLEAN    211 - 280
APAFDRHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMINFDFHQFAKGGKLEKLE    281 - 350
TLLRPQLKLHWEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALEVLHLQLKTLGLSSKPIV    351 - 420
DRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFFDGVKQEAIKLLLVGDVY    421 - 490
GEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVNGGKQFRSNVLRTAELTDWLL    491 - 560
DSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQKAISRSHRYILLTSAQLV    561 - 630
GVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDY    631 - 700
KEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFH    701 - 770
EGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLLDSDLDVDTKVRHTWSPG    771 - 840
ALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVVVNLQSPTLEEKNEFPED    841 - 910
LRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKIRPKTKDWLKGLREEIIR    911 - 980
KRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDEDYLVDEFNQPGVSDSELGGDDLSDVPGPTAL    981 - 1050
APPSKSPALTKKKQHPTYKDDADLVELKRELEAVGEFRHRSPSRSLSVPNRPRPPQPPQRPPPPTGLMVK   1051 - 1120
KSASDASISSGTHGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGA   1121 - 1190
SEEALSAVAPRDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQT   1191 - 1260
VHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVPPPLEAPPLVP   1261 - 1330
KVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAM   1331 - 1400
KPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHK   1401 - 1470
TLGHWVTISDQEKRTALQVFDPLAKT                                               1471 - 1496
//

Text Mined References (29)

PMID Year Title
25605973 2015 Synaptojanin 2 is a druggable mediator of metastasis and the gene is overexpressed and amplified in breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24077433 2014 Genetic interactions within inositol-related pathways are associated with longitudinal changes in ventricle size.
23300701 2012 Genome-wide search for gene-gene interactions in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23076136 Regulation of synaptojanin 2 5'-phosphatase activity by Src.
22823124 2013 The genetic aetiology of cannabis use initiation: a meta-analysis of genome-wide association studies and a SNP-based heritability estimation.
22213687 2012 Longevity candidate genes and their association with personality traits in the elderly.
22045296 2012 Evolutionary conserved longevity genes and human cognitive abilities in elderly cohorts.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
More...