Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.35
PubTator Score 15.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.300 1.9e-02
astrocytic glioma -2.800 1.3e-02
atypical teratoid/rhabdoid tumor -1.300 4.7e-03
Breast cancer 1.900 3.2e-02
ependymoma -2.900 1.9e-02
gastric carcinoma 1.200 2.1e-02
glioblastoma multiforme -1.200 5.9e-08
group 3 medulloblastoma -1.400 3.9e-02
lung adenocarcinoma 1.107 1.7e-04
lung cancer 1.300 6.8e-04
lung carcinoma 1.100 1.9e-18
medulloblastoma, large-cell -2.000 1.5e-04
non-small cell lung cancer 1.052 7.4e-10
oligodendroglioma -2.100 4.2e-02
osteosarcoma 1.175 3.2e-05
ovarian cancer -1.900 5.2e-06
Pick disease -1.500 4.4e-02
pituitary cancer -1.700 2.5e-05
primitive neuroectodermal tumor -1.600 6.0e-03
psoriasis -1.400 2.5e-03
subependymal giant cell astrocytoma -2.302 3.7e-02
tuberculosis -1.700 2.0e-07

Gene RIF (10)

AA Sequence

MALSKGLRLLGRLGAEGDCSVLLEARGRDDCLLFEAGTVATLAPEEKEVIKGQYGKLTDAYGCLGELRLK      1 - 70
SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALKKILSSGVFYFSWPNDGSRF     71 - 140
DLTVRTQKQGDDSSEWGNSFFWNQLLHVPLRQHQVSCCDWLLKIICGVVTIRTVYASHKQAKACLVSRVS    141 - 210
CERTGTRFHTRGVNDDGHVSNFVETEQMIYMDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLRLHRGLEAN    211 - 280
APAFDRHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMINFDFHQFAKGGKLEKLE    281 - 350
TLLRPQLKLHWEDFDVFTKGENVSPRFQKGTLRMNCLDCLDRTNTVQSFIALEVLHLQLKTLGLSSKPIV    351 - 420
DRFVESFKAMWSLNGHSLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFFDGVKQEAIKLLLVGDVY    421 - 490
GEEVADKGGMLLDSTALLVTPRILKAMTERQSEFTNFKRIRIAMGTWNVNGGKQFRSNVLRTAELTDWLL    491 - 560
DSPQLSGATDSQDDSSPADIFAVGFEEMVELSAGNIVNASTTNKKMWGEQLQKAISRSHRYILLTSAQLV    561 - 630
GVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDY    631 - 700
KEITQKLCFPMGRNVFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLLEFDQLQLQKSSGKIFKDFH    701 - 770
EGAINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPFDKTAGELNLLDSDLDVDTKVRHTWSPG    771 - 840
ALQYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSFQGPLDATVVVNLQSPTLEEKNEFPED    841 - 910
LRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKIRPKTKDWLKGLREEIIR    911 - 980
KRDSMAPVSPTANSCLLEENFDFTSLDYESEGDILEDDEDYLVDEFNQPGVSDSELGGDDLSDVPGPTAL    981 - 1050
APPSKSPALTKKKQHPTYKDDADLVELKRELEAVGEFRHRSPSRSLSVPNRPRPPQPPQRPPPPTGLMVK   1051 - 1120
KSASDASISSGTHGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGA   1121 - 1190
SEEALSAVAPRDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQT   1191 - 1260
VHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVPPPLEAPPLVP   1261 - 1330
KVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAM   1331 - 1400
KPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHK   1401 - 1470
TLGHWVTISDQEKRTALQVFDPLAKT                                               1471 - 1496
//

Text Mined References (30)

PMID Year Title