Property Summary

NCBI Gene PubMed Count 112
PubMed Score 424.17
PubTator Score 1262.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
breast carcinoma 1614 3.88344292051831E-20
lung cancer 4473 8.94117285140523E-6
psoriasis 6685 1.84436402031049E-5
cystic fibrosis 1670 5.93099711957035E-5
colon cancer 1475 1.45317136604207E-4
ovarian cancer 8492 2.06345579918756E-4
invasive ductal carcinoma 2950 2.12228414384116E-4
cutaneous lupus erythematosus 1056 4.222575984723E-4
atypical teratoid / rhabdoid tumor 4369 5.08150649741721E-4
osteosarcoma 7933 0.00138677068408037
dermatomyositis 967 0.00216648530080675
medulloblastoma, large-cell 6234 0.0101184129217405
chronic rhinosinusitis 512 0.0105153784816318
aldosterone-producing adenoma 664 0.0105285069676552
Endometriosis 535 0.0153751250323438
glioblastoma 5572 0.0197054322966091
Breast cancer 3099 0.0270162221104319
spina bifida 1064 0.0445305246136197
astrocytic glioma 2241 0.04913562435219
subependymal giant cell astrocytoma 2287 0.049945351378786
Disease Target Count Z-score Confidence
Sleep disorder 4 4.545 2.3
Seasonal affective disorder 25 4.189 2.1
Cancer 2346 3.293 1.6

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.300 0.049
cutaneous lupus erythematosus -1.600 0.000
psoriasis -2.300 0.000
osteosarcoma -2.235 0.001
cystic fibrosis 1.107 0.000
atypical teratoid / rhabdoid tumor -1.700 0.001
glioblastoma -1.300 0.020
medulloblastoma, large-cell -1.100 0.010
lung cancer -2.100 0.000
colon cancer -2.000 0.000
Breast cancer -2.500 0.027
aldosterone-producing adenoma -1.075 0.011
subependymal giant cell astrocytoma -1.397 0.050
invasive ductal carcinoma -1.400 0.000
Endometriosis -1.309 0.015
breast carcinoma -1.200 0.000
spina bifida -1.418 0.045
ovarian cancer -1.200 0.000
chronic rhinosinusitis -1.430 0.011
dermatomyositis 1.200 0.002

Synonym

Accession O15055 A2I2P7 Q4ZG49 Q6DT41 Q9UQ45 hPER2
Symbols FASPS
FASPS1

Gene

  Ortholog (13)

Gene RIF (100)

PMID Text
26283734 Data suggest that PER2 functions as the only clock gene needed to maintain undifferentiated state of endothelial progenitor cells; expression of PER2-regulatory microRNA, miR-92a, is down-regulated in diabetic retinopathy.
26247999 possible circadian rhythm in full-term placental expression
25799324 ARNTL and PER2 genetic variants associate in psychotic disorders Depresssion
25688509 Deregulated expression of the PER2 genes is common in glioma, and inactivation of PER2 expression in glioma cells may result in deregulation of the cell cycle, thus promoting the proliferation of glioma cells.
25573754 RNA sequencing revealed that premature inhibition of PER2 by small interfering RNA knockdown leads to a grossly disorganized decidual response.
25550826 In patients with non-small cell lung cancer, those with lower expression of Per1, Per2 and Per3 had a shorter survival time than those with higher expression.
25411341 Data indicate that the period circadian protein Per2 modulates hp53 protein signaling in response to genotoxic stress.
25313752 deregulated of the PER2 genes in glioma cells in deregulation of the cell cycle favoring proliferation of tumor cells.
25216061 The biological effects of the per2 gene and its protein product, PER2, in the limbic system. [Review]
25103245 The findings place hPer2 directly at the heart of the hp53-mediated response by ensuring that basal levels of hp53 are available to precondition the cell when a rapid, hp53-mediated, transcriptional response is needed.
More...

AA Sequence

MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVE      1 - 70
PPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKVHLPADKKAKGKASTLATLKY     71 - 140
ALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQ    141 - 210
VASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSH    211 - 280
ENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERA    281 - 350
VPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP    351 - 420
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGS    421 - 490
HEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEK    491 - 560
DSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEAATLKRKCEFPANVPALRSSDKRKATVSPGP    561 - 630
HAGEAEPPSRVNSRTGVGTHLTSLALPGKAESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPES    631 - 700
LDCLAGPALACGLSQEKEPFKKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQP    701 - 770
SERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS    771 - 840
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPLAPVMAFMLPS    841 - 910
YSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPCACPATRATPPSAMGRASPPL    911 - 980
FQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGADCKPGTSRDQQPKAPLTRDEPSDTQNSDAL    981 - 1050
STSSGLLNLLLNEDLCSASGSAASESLGSGSLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTG   1051 - 1120
MEESEHFIKCVLQDPIWLLMADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREV   1121 - 1190
HQWMQTGGLPAAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT        1191 - 1255
//

Text Mined References (115)

PMID Year Title
26283734 2015 miR-92a Corrects CD34+ Cell Dysfunction in Diabetes by Modulating Core Circadian Genes Involved in Progenitor Differentiation.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
25799324 2015 Depression-associated ARNTL and PER2 genetic variants in psychotic disorders.
25688509 Correlation between deregulated expression of PER2 gene and degree of glioma malignancy.
25573754 2015 The clock protein period 2 synchronizes mitotic expansion and decidual transformation of human endometrial stromal cells.
25550826 2014 Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.
25411341 2015 Association of the circadian factor Period 2 to p53 influences p53's function in DNA-damage signaling.
25313752 The analysis of deregulated expression and methylation of the PER2 genes in gliomas.
25216061 2014 Research progress on the central mechanism underlying regulation of visceral biological rhythm by per2 (Review).
25103245 2014 The circadian factor Period 2 modulates p53 stability and transcriptional activity in unstressed cells.
More...