Property Summary

Ligand Count 34
NCBI Gene PubMed Count 126
PubMed Score 457.40
PubTator Score 1262.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Seasonal affective disorder 28 4.173 2.1

Expression

  Differential Expression (20)

Disease log2 FC p
aldosterone-producing adenoma -1.075 1.1e-02
astrocytic glioma -1.300 4.9e-02
atypical teratoid / rhabdoid tumor -1.700 5.1e-04
Breast cancer -2.500 2.7e-02
breast carcinoma -1.200 3.9e-20
chronic rhinosinusitis -1.430 1.1e-02
colon cancer -2.000 1.5e-04
cutaneous lupus erythematosus -1.600 4.2e-04
cystic fibrosis 1.107 5.9e-05
dermatomyositis 1.200 2.2e-03
Endometriosis -1.309 1.5e-02
glioblastoma -1.300 2.0e-02
invasive ductal carcinoma -1.245 2.2e-02
lung cancer -1.500 2.8e-02
medulloblastoma, large-cell -1.100 1.0e-02
osteosarcoma -2.235 1.4e-03
ovarian cancer -1.200 2.1e-04
psoriasis -1.300 9.3e-03
spina bifida -1.418 4.5e-02
subependymal giant cell astrocytoma -1.397 5.0e-02

Protein-protein Interaction (4)

Gene RIF (112)

AA Sequence

MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVE      1 - 70
PPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKVHLPADKKAKGKASTLATLKY     71 - 140
ALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQ    141 - 210
VASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSH    211 - 280
ENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERA    281 - 350
VPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP    351 - 420
WSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGS    421 - 490
HEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEK    491 - 560
DSLGVSFPEELACKNQPTCSYQQISCLDSVIRYLESCNEAATLKRKCEFPANVPALRSSDKRKATVSPGP    561 - 630
HAGEAEPPSRVNSRTGVGTHLTSLALPGKAESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPES    631 - 700
LDCLAGPALACGLSQEKEPFKKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQP    701 - 770
SERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSS    771 - 840
CPAVPFPAPVPAAYSLPVFPAPGTVAAPPAPPHASFTVPAVPVDLQHQFAVQPPPFPAPLAPVMAFMLPS    841 - 910
YSFPSGTPNLPQAFFPSQPQFPSHPTLTSEMASASQPEFPSRTSIPRQPCACPATRATPPSAMGRASPPL    911 - 980
FQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAAVGADCKPGTSRDQQPKAPLTRDEPSDTQNSDAL    981 - 1050
STSSGLLNLLLNEDLCSASGSAASESLGSGSLGCDASPSGAGSSDTSHTSKYFGSIDSSENNHKAKMNTG   1051 - 1120
MEESEHFIKCVLQDPIWLLMADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREV   1121 - 1190
HQWMQTGGLPAAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT        1191 - 1255
//

Text Mined References (129)

PMID Year Title