Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.18
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.429 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.300 0.000
tuberculosis -1.100 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.001
lung cancer -3.100 0.001
ovarian cancer 1.800 0.000

Synonym

Accession O15037 Q86TZ6 Q8IUQ2 Q96BA9
Symbols KIAA0323

Gene

PANTHER Protein Class (1)

PDB

2N5M   2N7K  

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPTWGARPASPDRFAVSAEAENKVREQQPHVERIFSVGVSVLPKDCPDNPHIWLQLEGPKENASRAKEYL      1 - 70
KGLCSPELQDEIHYPPKLHCIFLGAQGFFLDCLAWSTSAHLVPRAPGSLMISGLTEAFVMAQSRVEELAE     71 - 140
RLSWDFTPGPSSGASQCTGVLRDFSALLQSPGDAHREALLQLPLAVQEELLSLVQEASSGQGPGALASWE    141 - 210
GRSSALLGAQCQGVRAPPSDGRESLDTGSMGPGDCRGARGDTYAVEKEGGKQGGPREMDWGWKELPGEEA    211 - 280
WEREVALRPQSVGGGARESAPLKGKALGKEEIALGGGGFCVHREPPGAHGSCHRAAQSRGASLLQRLHNG    281 - 350
NASPPRVPSPPPAPEPPWHCGDRGDCGDRGDVGDRGDKQQGMARGRGPQWKRGARGGNLVTGTQRFKEAL    351 - 420
QDPFTLCLANVPGQPDLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVFVPQWRFSKDA    421 - 490
KVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIVSNDQFRDLAEESEKWMAIIR    491 - 560
ERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGSSKAQHPSRGFAEHGKQQQGREEEKGSGGIR    561 - 630
KTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDINQLSEALLSLNF                          631 - 678
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19561090 2009 CGIN1: a retroviral contribution to mammalian genomes.
17114934 The NYN domains: novel predicted RNAses with a PIN domain-like fold.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...