Property Summary

NCBI Gene PubMed Count 21
PubMed Score 68.27
PubTator Score 26.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
Breast cancer -1.100 1.3e-02
Astrocytoma, Pilocytic 1.200 1.1e-02
Atopic dermatitis -1.100 2.6e-04
atypical teratoid / rhabdoid tumor -3.000 1.3e-07
Barrett's esophagus -1.100 4.3e-02
breast carcinoma -1.400 2.7e-03
ductal carcinoma in situ -2.200 6.3e-04
Endometriosis -1.366 4.0e-02
ependymoma -1.300 6.9e-04
esophageal adenocarcinoma -1.700 2.1e-02
fibroadenoma -1.800 1.4e-02
glioblastoma -1.700 3.5e-02
group 4 medulloblastoma -1.300 7.7e-03
intraductal papillary-mucinous adenoma (... 1.800 1.2e-02
invasive ductal carcinoma -3.200 5.5e-03
lung adenocarcinoma -1.400 2.3e-10
lung cancer -3.200 7.7e-05
lung carcinoma -1.800 7.5e-19
malignant mesothelioma 1.800 1.7e-05
medulloblastoma, large-cell -4.000 2.9e-06
nasopharyngeal carcinoma -1.300 6.8e-03
non-small cell lung cancer -2.325 7.2e-14
oligodendroglioma 1.200 1.3e-02
ovarian cancer -2.800 5.6e-08
Pick disease 1.300 1.3e-04
pituitary cancer -1.700 1.1e-03
primitive neuroectodermal tumor -2.100 6.1e-03
progressive supranuclear palsy 1.400 4.8e-03
psoriasis -1.100 1.1e-04
spina bifida -2.749 4.1e-02
subependymal giant cell astrocytoma -3.130 2.3e-02

Gene RIF (10)

AA Sequence

MPITQDNAVLHLPLLYQWLQNSLQEGGDGPEQRLCQAAIQKLQEYIQLNFAVDESTVPPDHSPPEMEICT      1 - 70
VYLTKELGDTETVGLSFGNIPVFGDYGEKRRGGKKRKTHQGPVLDVGCIWVTELRKNSPAGKSGKVRLRD     71 - 140
EILSLNGQLMVGVDVSGASYLAEQCWNGGFIYLIMLRRFKHKAHSTYNGNSSNSSEPGETPTLELGDRTA    141 - 210
KKGKRTRKFGVISRPPANKAPEESKGSAGCEVSSDPSTELENGPDPELGNGHVFQLENGPDSLKEVAGPH    211 - 280
LERSEVDRGTEHRIPKTDAPLTTSNDKRRFSKGGKTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSG    281 - 350
GRGSKRSPHAIVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVAILRSATGMVQLVVASKEN    351 - 420
SAEDLLRLTSKSLPDLTSSVEDVSSWTDNEDQEADGEEDEGTSSSVQRAMPGTDEPQDVCGAEESKGNLE    421 - 490
SPKQGSNKIKLKSRLSGGVHRLESVEEYNELMVRNGDPRIRMLEVSRDGRKHSLPQLLDSSSASQEYHIV    491 - 560
KKSTRSLSTTQVESPWRLIRPSVISIIGLYKEKGKGLGFSIAGGRDCIRGQMGIFVKTIFPNGSAAEDGR    561 - 630
LKEGDEILDVNGIPIKGLTFQEAIHTFKQIRSGLFVLTVRTKLVSPSLTPCSTPTHMSRSASPNFNTSGG    631 - 700
ASAGGSDEGSSSSLGRKTPGPKDRIVMEVTLNKEPRVGLGIGACCLALENSPPGIYIHSLAPGSVAKMES    701 - 770
NLSRGDQILEVNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESKEANS    771 - 840
SPGLGTPLKSPSLAKKDSLISESELSQYFAHDVPGPLSDFMVAGSEDEDHPGSGCSTSEEGSLPPSTSTH    841 - 910
KEPGKPRANSLVTLGSHRASGLFHKQVTVARQASLPGSPQALRNPLLRQRKVGCYDANDASDEEEFDREG    911 - 980
DCISLPGALPGPIRPLSEDDPRRVSISSSKGMDVHNQEERPRKTLVSKAISAPLLGSSVDLEESIPEGMV    981 - 1050
DAASYAANLTDSAEAPKGSPGSWWKKELSGSSSAPKLEYTVRTDTQSPTNTGSPSSPQQKSEGLGSRHRP   1051 - 1120
VARVSPHCKRSEAEAKPSGSQTVNLTGRANDPCDLDSRVQATSVKVTVAGFQPGGAVEKESLGKLTTGDA   1121 - 1190
CVSTSCELASALSHLDASHLTENLPKAASELGQQPMTELDSSSDLISSPGKKGAAHPDPSKTSVDTGQVS   1191 - 1260
RPENPSQPASPRVTKCKARSPVRLPHEGSPSPGEKAAAPPDYSKTRSASETSTPHNTRRVAALRGAGPGA   1261 - 1330
EGMTPAGAVLPGDPLTSQEQRQGAPGNHSKALEMTGIHAPESSQEPSLLEGADSVSSRAPQASLSMLPST   1331 - 1400
DNTKEACGHVSGHCCPGGSRESPVTDIDSFIKELDASAARSPSSQTGDSGSQEGSAQGHPPAGAGGGSSC   1401 - 1470
RAEPVPGGQTSSPRRAWAAGAPAYPQWASQPSVLDSINPDKHFTVNKNFLSNYSRNFSSFHEDSTSLSGL   1471 - 1540
GDSTEPSLSSMYGDAEDSSSDPESLTEAPRASARDGWSPPRSRVSLHKEDPSESEEEQIEICSTRGCPNP   1541 - 1610
PSSPAHLPTQAAICPASAKVLSLKYSTPRESVASPREKAACLPGSYTSGPDSSQPSSLLEMSSQEHETHA   1611 - 1680
DISTSQNHRPSCAEETTEVTSASSAMENSPLSKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETS   1681 - 1750
INAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKPKMIARRPIMAWFKEINKHNQGTHLRSKTEK   1751 - 1820
EQPLMPARSPDSKIQMVSSSQKKGVTVPHSPPQPKTNLENKDLSKKSPAEMLLTNGQKAKCGPKLKRLSL   1821 - 1890
KGKAKVNSEAPAANAVKAGGTDHRKPLISPQTSHKTLSKAVSQRLHVADHEDPDRNTTAAPRSPQCVLES   1891 - 1960
KPPLATSGPLKPSVSDTSIRTFVSPLTSPKPVPEQGMWSRFHMAVLSEPDRGCPTTPKSPKCRAEGRAPR   1961 - 2030
ADSGPVSPAASRNGMSVAGNRQSEPRLASHVAADTAQPRPTGEKGGNIMASDRLERTNQLKIVEISAEAV   2031 - 2100
SETVCGNKPAESDRRGGCLAQGNCQEKSEIRLYRQVAESSTSHPSSLPSHASQAEQEMSRSFSMAKLASS   2101 - 2170
SSSLQTAIRKAEYSQGKSSLMSDSRGVPRNSIPGGPSGEDHLYFTPRPATRTYSMPAQFSSHFGREGHPP   2171 - 2240
HSLGRSRDSQVPVTSSVVPEAKASRGGLPSLANGQGIYSVKPLLDTSRNLPATDEGDIISVQETSCLVTD   2241 - 2310
KIKVTRRHYCYEQNWPHESTSFFSVKQRIKSFENLANADRPVAKSGASPFLSVSSKPPIGRRSSGSIVSG   2311 - 2380
SLGHPGDAAARLLRRSLSSCSENQSEAGTLLPQMAKSPSIMTLTISRQNPPETSSKGSDSELKKSLGPLG   2381 - 2450
IPTPTMTLASPVKRNKSSVRHTQPSPVSRSKLQELRALSMPDLDKLCSEDYSAGPSAVLFKTELEITPRR   2451 - 2520
SPGPPAGGVSCPEKGGNRACPGGSGPKTSAAETPSSASDTGEAAQDLPFRRSWSVNLDQLLVSAGDQQRL   2521 - 2590
QSVLSSVGSKSTILTLIQEAKAQSENEEDVCFIVLNRKEGSGLGFSVAGGTDVEPKSITVHRVFSQGAAS   2591 - 2660
QEGTMNRGDFLLSVNGASLAGLAHGNVLKVLHQAQLHKDALVVIKKGMDQPRPSARQEPPTANGKGLLSR   2661 - 2730
KTIPLEPGIGRSVAVHDALCVEVLKTSAGLGLSLDGGKSSVTGDGPLVIKRVYKGGAAEQAGIIEAGDEI   2731 - 2800
LAINGKPLVGLMHFDAWNIMKSVPEGPVQLLIRKHRNSS                                  2801 - 2839
//

Text Mined References (21)

PMID Year Title