Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 5
Funding $671,194.91
PubMed Score 69.08
PubTator Score 26.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
oligodendroglioma 1.200 0.013
Barrett's esophagus -1.100 0.043
esophageal adenocarcinoma -1.700 0.021
psoriasis -1.400 0.000
ependymoma -1.300 0.001
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
glioblastoma -1.700 0.035
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.100 0.006
Atopic dermatitis -1.100 0.000
non-small cell lung cancer -2.325 0.000
intraductal papillary-mucinous adenoma (... 2.200 0.005
lung cancer -3.200 0.000
breast carcinoma -1.400 0.003
fibroadenoma -1.800 0.014
lung adenocarcinoma -2.000 0.000
pilocytic astrocytoma 1.800 0.000
subependymal giant cell astrocytoma -3.130 0.023
nasopharyngeal carcinoma -1.300 0.007
Endometriosis -1.366 0.040
lung carcinoma -1.800 0.000
spina bifida -2.749 0.041
Pick disease 1.300 0.000
progressive supranuclear palsy 1.400 0.005
Breast cancer -1.100 0.013
ductal carcinoma in situ -2.200 0.001
invasive ductal carcinoma -3.200 0.005
ovarian cancer -3.300 0.000
pituitary cancer -1.700 0.001

Gene RIF (10)

PMID Text
24827138 The DNA copy number variations disrupt PDZD2 and GOLPH3 genes predominantly expressed in placenta, and it may represent a novel risk factor for recurrent miscarriage.
21451436 This study does not support the association of PDZD2, GOLPH3, and MTMR12 genes with schizophrenia.
21061259 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19046020 PDZ-domain containing-2 (PDZD2) drives the maturity of human fetal pancreatic progenitor-derived islet-like cell clusters with functional responsiveness against membrane depolarization.
18639375 sPDZD2 sensitized mutant p53-positive DU145 cells and wild-type p53-positive MCF-7 cells to apoptosis induction through genotoxic stress imposed by sub-lethal concentration of hydrogen peroxide
18037333 Results show that a novel pancreatic developmental factor, PDZD2, is sufficient to promote the proliferation of human fetal PPCs while limiting differentiation of ICCs into islet/endocrine cells.
16413998 The mitogenic effect of secreted PDZD2 was concentration-dependent, and was associated with a slight inhibition of the insulin promoter activity at high sPDZD2 concentrations.
12671685 the first reported multi-PDZ protein that is processed by proteolytic cleavage to generate a secreted peptide containing two PDZ domains

AA Sequence

MPITQDNAVLHLPLLYQWLQNSLQEGGDGPEQRLCQAAIQKLQEYIQLNFAVDESTVPPDHSPPEMEICT      1 - 70
VYLTKELGDTETVGLSFGNIPVFGDYGEKRRGGKKRKTHQGPVLDVGCIWVTELRKNSPAGKSGKVRLRD     71 - 140
EILSLNGQLMVGVDVSGASYLAEQCWNGGFIYLIMLRRFKHKAHSTYNGNSSNSSEPGETPTLELGDRTA    141 - 210
KKGKRTRKFGVISRPPANKAPEESKGSAGCEVSSDPSTELENGPDPELGNGHVFQLENGPDSLKEVAGPH    211 - 280
LERSEVDRGTEHRIPKTDAPLTTSNDKRRFSKGGKTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSG    281 - 350
GRGSKRSPHAIVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVAILRSATGMVQLVVASKEN    351 - 420
SAEDLLRLTSKSLPDLTSSVEDVSSWTDNEDQEADGEEDEGTSSSVQRAMPGTDEPQDVCGAEESKGNLE    421 - 490
SPKQGSNKIKLKSRLSGGVHRLESVEEYNELMVRNGDPRIRMLEVSRDGRKHSLPQLLDSSSASQEYHIV    491 - 560
KKSTRSLSTTQVESPWRLIRPSVISIIGLYKEKGKGLGFSIAGGRDCIRGQMGIFVKTIFPNGSAAEDGR    561 - 630
LKEGDEILDVNGIPIKGLTFQEAIHTFKQIRSGLFVLTVRTKLVSPSLTPCSTPTHMSRSASPNFNTSGG    631 - 700
ASAGGSDEGSSSSLGRKTPGPKDRIVMEVTLNKEPRVGLGIGACCLALENSPPGIYIHSLAPGSVAKMES    701 - 770
NLSRGDQILEVNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTYQESKEANS    771 - 840
SPGLGTPLKSPSLAKKDSLISESELSQYFAHDVPGPLSDFMVAGSEDEDHPGSGCSTSEEGSLPPSTSTH    841 - 910
KEPGKPRANSLVTLGSHRASGLFHKQVTVARQASLPGSPQALRNPLLRQRKVGCYDANDASDEEEFDREG    911 - 980
DCISLPGALPGPIRPLSEDDPRRVSISSSKGMDVHNQEERPRKTLVSKAISAPLLGSSVDLEESIPEGMV    981 - 1050
DAASYAANLTDSAEAPKGSPGSWWKKELSGSSSAPKLEYTVRTDTQSPTNTGSPSSPQQKSEGLGSRHRP   1051 - 1120
VARVSPHCKRSEAEAKPSGSQTVNLTGRANDPCDLDSRVQATSVKVTVAGFQPGGAVEKESLGKLTTGDA   1121 - 1190
CVSTSCELASALSHLDASHLTENLPKAASELGQQPMTELDSSSDLISSPGKKGAAHPDPSKTSVDTGQVS   1191 - 1260
RPENPSQPASPRVTKCKARSPVRLPHEGSPSPGEKAAAPPDYSKTRSASETSTPHNTRRVAALRGAGPGA   1261 - 1330
EGMTPAGAVLPGDPLTSQEQRQGAPGNHSKALEMTGIHAPESSQEPSLLEGADSVSSRAPQASLSMLPST   1331 - 1400
DNTKEACGHVSGHCCPGGSRESPVTDIDSFIKELDASAARSPSSQTGDSGSQEGSAQGHPPAGAGGGSSC   1401 - 1470
RAEPVPGGQTSSPRRAWAAGAPAYPQWASQPSVLDSINPDKHFTVNKNFLSNYSRNFSSFHEDSTSLSGL   1471 - 1540
GDSTEPSLSSMYGDAEDSSSDPESLTEAPRASARDGWSPPRSRVSLHKEDPSESEEEQIEICSTRGCPNP   1541 - 1610
PSSPAHLPTQAAICPASAKVLSLKYSTPRESVASPREKAACLPGSYTSGPDSSQPSSLLEMSSQEHETHA   1611 - 1680
DISTSQNHRPSCAEETTEVTSASSAMENSPLSKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETS   1681 - 1750
INAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKPKMIARRPIMAWFKEINKHNQGTHLRSKTEK   1751 - 1820
EQPLMPARSPDSKIQMVSSSQKKGVTVPHSPPQPKTNLENKDLSKKSPAEMLLTNGQKAKCGPKLKRLSL   1821 - 1890
KGKAKVNSEAPAANAVKAGGTDHRKPLISPQTSHKTLSKAVSQRLHVADHEDPDRNTTAAPRSPQCVLES   1891 - 1960
KPPLATSGPLKPSVSDTSIRTFVSPLTSPKPVPEQGMWSRFHMAVLSEPDRGCPTTPKSPKCRAEGRAPR   1961 - 2030
ADSGPVSPAASRNGMSVAGNRQSEPRLASHVAADTAQPRPTGEKGGNIMASDRLERTNQLKIVEISAEAV   2031 - 2100
SETVCGNKPAESDRRGGCLAQGNCQEKSEIRLYRQVAESSTSHPSSLPSHASQAEQEMSRSFSMAKLASS   2101 - 2170
SSSLQTAIRKAEYSQGKSSLMSDSRGVPRNSIPGGPSGEDHLYFTPRPATRTYSMPAQFSSHFGREGHPP   2171 - 2240
HSLGRSRDSQVPVTSSVVPEAKASRGGLPSLANGQGIYSVKPLLDTSRNLPATDEGDIISVQETSCLVTD   2241 - 2310
KIKVTRRHYCYEQNWPHESTSFFSVKQRIKSFENLANADRPVAKSGASPFLSVSSKPPIGRRSSGSIVSG   2311 - 2380
SLGHPGDAAARLLRRSLSSCSENQSEAGTLLPQMAKSPSIMTLTISRQNPPETSSKGSDSELKKSLGPLG   2381 - 2450
IPTPTMTLASPVKRNKSSVRHTQPSPVSRSKLQELRALSMPDLDKLCSEDYSAGPSAVLFKTELEITPRR   2451 - 2520
SPGPPAGGVSCPEKGGNRACPGGSGPKTSAAETPSSASDTGEAAQDLPFRRSWSVNLDQLLVSAGDQQRL   2521 - 2590
QSVLSSVGSKSTILTLIQEAKAQSENEEDVCFIVLNRKEGSGLGFSVAGGTDVEPKSITVHRVFSQGAAS   2591 - 2660
QEGTMNRGDFLLSVNGASLAGLAHGNVLKVLHQAQLHKDALVVIKKGMDQPRPSARQEPPTANGKGLLSR   2661 - 2730
KTIPLEPGIGRSVAVHDALCVEVLKTSAGLGLSLDGGKSSVTGDGPLVIKRVYKGGAAEQAGIIEAGDEI   2731 - 2800
LAINGKPLVGLMHFDAWNIMKSVPEGPVQLLIRKHRNSS                                  2801 - 2839
//

Text Mined References (21)

PMID Year Title
24827138 2014 Structural genomic variation as risk factor for idiopathic recurrent miscarriage.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23184150 2013 Common variation at 2q22.3 (ZEB2) influences the risk of renal cancer.
21451436 2012 Mutation screening of PDZD2, GOLPH3, and MTMR12 genes in patients with schizophrenia.
21061259 2011 Genome-wide association study of genetic predictors of anti-tumor necrosis factor treatment efficacy in rheumatoid arthritis identifies associations with polymorphisms at seven loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19046020 2009 PDZ-domain containing-2 (PDZD2) drives the maturity of human fetal pancreatic progenitor-derived islet-like cell clusters with functional responsiveness against membrane depolarization.
More...