Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MSASTSSHRPIKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATYRDYDLMKANE      1 - 70
PGTSYMSVQDNGEDSVRDVEGEDSVRGVEGKEATDASDHSCEVDEQESSEAYMRKILLHKQEKKRQFEMR     71 - 140
RRLHYNEELNIKLARQLMWKELQSEDNENEETPQGTNEEKTAAEESEEAPLTGGLQTQSCDP            141 - 202
//

Text Mined References (7)

PMID Year Title