Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
11948623 A streamlined nomenclature for human primary regulators of type-1 protein phosphatase (PP1) genes and pseudogenes is proposed.
11883959 inhibitor-1beta consisted of 132 amino acids of which the N-terminal 61 amino acid sequences were identical to inhibitor-1 while the sequence after residue-61 was markedly different.

AA Sequence

MSASTSSHRPIKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATYRDYDLMKANE      1 - 70
PGTSYMSVQDNGEDSVRDVEGEDSVRGVEGKEATDASDHSCEVDEQESSEAYMRKILLHKQEKKRQFEMR     71 - 140
RRLHYNEELNIKLARQLMWKELQSEDNENEETPQGTNEEKTAAEESEEAPLTGGLQTQSCDP            141 - 202
//

Text Mined References (7)

PMID Year Title
24195737 2013 Not so pseudo: the evolutionary history of protein phosphatase 1 regulatory subunit 2 and related pseudogenes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.
11076525 2000 Identification and characterization of a novel protein inhibitor of type 1 protein phosphatase.
7949733 1994 Cloning and characterization of human phosphatase inhibitor-2 (IPP-2) sequences.