Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.34
PubTator Score 10.96

Knowledge Summary

Patent (2,309)

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.062 7.5e-05
adult high grade glioma -2.700 6.3e-04
Amyotrophic lateral sclerosis 1.563 1.1e-07
astrocytic glioma -2.800 1.7e-03
Astrocytoma, Pilocytic -3.000 8.0e-08
atypical teratoid / rhabdoid tumor -3.500 7.3e-05
Barrett's esophagus 2.500 2.9e-02
Breast cancer -2.000 2.7e-06
ependymoma -3.400 2.2e-03
esophageal adenocarcinoma 2.700 1.8e-02
glioblastoma -2.700 5.3e-08
group 3 medulloblastoma -4.600 8.5e-06
interstitial cystitis 1.700 8.0e-03
intraductal papillary-mucinous adenoma (... 1.800 8.3e-05
intraductal papillary-mucinous carcinoma... 1.900 6.5e-05
intraductal papillary-mucinous neoplasm ... 2.000 1.8e-03
lung adenocarcinoma -1.500 1.5e-09
lung cancer -1.700 8.1e-04
lung carcinoma -2.000 3.3e-23
medulloblastoma, large-cell -4.800 5.5e-08
non-small cell lung cancer -2.894 1.0e-25
oligodendroglioma -2.600 4.1e-03
osteosarcoma -3.289 1.1e-04
ovarian cancer -3.200 5.7e-15
periodontitis 1.400 1.6e-22
pituitary cancer -3.200 3.1e-07
primitive neuroectodermal tumor -3.500 1.7e-04
subependymal giant cell astrocytoma -1.643 2.6e-02
tuberculosis 1.400 7.7e-07
ulcerative colitis -1.091 3.1e-02

Gene RIF (9)

AA Sequence

MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVVESVFLPSEGS      1 - 70
NLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFVTSDDEFIIKTV     71 - 140
QHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRSMRMHFTYDLKGSTYK    141 - 210
RRASRKEREKSNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSL    211 - 280
KEKEEETPQNVPDAKRTGMQKVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIID    281 - 350
ILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT    351 - 420
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTISSSSLYVNEHY    421 - 490
PHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL                        491 - 540
//

Text Mined References (26)

PMID Year Title