Property Summary

NCBI Gene PubMed Count 23
Grant Count 36
R01 Count 32
Funding $2,933,934.07
PubMed Score 62.05
PubTator Score 15.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 0.013
oligodendroglioma 1.300 0.009
osteosarcoma -1.894 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.017
X-linked cerebral adrenoleukodystrophy -1.100 0.044
ovarian cancer -2.200 0.000
dermatomyositis 1.700 0.000

Gene RIF (17)

PMID Text
20627952 Results support a model for a BTAF1-mediated release of TBP-NC2 complexes from chromatin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19454010 HIV-1 Tat binds, through amino acids 36-50, directly to the TBP subunit of the TFIID holoenzyme complex (which includes at least TFIID subunits p250, p125, p70, TBP, and p30), and increases the interaction of TFIID with the HIV-1 LTR promoter
18025106 histone acetylation, although it occurs, is dispensable for TFIID and SWI/SNF recruitment by the strong enhancers
16531235 We propose that these density rearrangements in the structure are a likely reflection of the plasticity of the interactions between TFIID and its many partner proteins.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15509807 physical cooperation between BTAF1 and NC2alpha in TBP regulation
14988402 study with the first structural model of the B-TFIID complex and map of its key functional domains
9054383 HIV-1 Tat binds, through amino acids 36-50, directly to the TBP subunit of the TFIID holoenzyme complex (which includes at least TFIID subunits p250, p125, p70, TBP, and p30), and increases the interaction of TFIID with the HIV-1 LTR promoter
8849451 HIV-1 Tat binds, through amino acids 36-50, directly to the TBP subunit of the TFIID holoenzyme complex (which includes at least TFIID subunits p250, p125, p70, TBP, and p30), and increases the interaction of TFIID with the HIV-1 LTR promoter
More...

AA Sequence

MAVSRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRIAAGQAVEAIV      1 - 70
KNVPEWNPVPRTRQEPTSESSMEDSPTTERLNFDRFDICRLLQHGASLLGSAGAEFEVQDEKSGEVDPKE     71 - 140
RIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTSASFVNKQPTLQAAELIDSEFRAGMSNRQKN    141 - 210
KAKRMAKLFAKQRSRDAVETNEKSNDSTDGEPEEKRRKIANVVINQSANDSKVLIDNIPDSSSLIEETNE    211 - 280
WPLESFCEELCNDLFNPSWEVRHGAGTGLREILKAHGKSGGKMGDSTLEEMIQQHQEWLEDLVIRLLCVF    281 - 350
ALDRFGDFVSDEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVR    351 - 420
QDVINTLLPKVLTRIIEGLQDLDDDVRAVAAASLVPVVESLVYLQTQKVPFIINTLWDALLELDDLTAST    421 - 490
NSIMTLLSSLLTYPQVQQCSIQQSLTVLVPRVWPFLHHTISSVRRAALETLFTLLSTQDQNSSSWLIPIL    491 - 560
PDMLRHIFQFCVLESSQEILDLIHKVWMELLSKASVQYVVAAACPWMGAWLCLMMQPSHLPIDLNMLLEV    561 - 630
KARAKEKTGGKVRQGQSQNKEVLQEYIAGADTIMEDPATRDFVVMRARMMAAKLLGALCCCICDPGVNVV    631 - 700
TQEIKPAESLGQLLLFHLNSKSALQRISVALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYDEIAVP    701 - 770
FTRMQNECKQLISSLADVHIEVGNRVNNNVLTIDQASDLVTTVFNEATSSFDLNPQVLQQLDSKRQQVQM    771 - 840
TVTETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETIKKEENTLVQNYAAQCIAKLLQQCTT    841 - 910
RTPCPNSKIIKNLCSSLCVDPYLTPCVTCPVPTQSGQENSKGSTSEKDGMHHTVTKHRGIITLYRHQKAA    911 - 980
FAITSRRGPTPKAVKAQIADLPAGSSGNILVELDEAQKPYLVQRRGAEFALTTIVKHFGGEMAVKLPHLW    981 - 1050
DAMVGPLRNTIDINNFDGKSLLDKGDSPAQELVNSLQVFETAAASMDSELHPLLVQHLPHLYMCLQYPST   1051 - 1120
AVRHMAARCVGVMSKIATMETMNIFLEKVLPWLGAIDDSVKQEGAIEALACVMEQLDVGIVPYIVLLVVP   1121 - 1190
VLGRMSDQTDSVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPV   1191 - 1260
PINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSKLAECMPLPSL   1261 - 1330
VVCPPTLTGHWVDEVGKFCSREYLNPLHYTGPPTERIRLQHQVKRHNLIVASYDVVRNDIDFFRNIKFNY   1331 - 1400
CILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPIL   1401 - 1470
ASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRA   1471 - 1540
KCDVDETVSSATLSEETEKPKLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTAEKLAVQNSSLHDI   1541 - 1610
QHAPKLSALKQLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGS   1611 - 1680
IPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVN   1681 - 1750
VYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMK   1751 - 1820
SILENLSDLWDQEQYDSEYSLENFMHSLK                                            1821 - 1849
//

Text Mined References (27)

PMID Year Title
23361013 2013 FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20627952 2010 Chromatin interaction of TATA-binding protein is dynamically regulated in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18025106 2008 Bypassing the requirements for epigenetic modifications in gene transcription by increasing enhancer strength.
16531235 2006 Cryo-electron microscopy studies of human TFIID: conformational breathing in the integration of gene regulatory cues.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15509807 2004 NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
More...