Property Summary

NCBI Gene PubMed Count 234
PubMed Score 1175.41
PubTator Score 681.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 1.73620453510797E-14
juvenile dermatomyositis 1189 7.28966580278991E-13
adrenocortical carcinoma 1427 3.27085561389357E-9
acute quadriplegic myopathy 1157 2.67949611703655E-6
lung cancer 4473 1.09811708045085E-4
adrenocortical adenoma 134 1.64629954633294E-4
dermatomyositis 967 2.01476687660711E-4
sonic hedgehog group medulloblastoma 1482 2.03225622625535E-4
inflammatory breast cancer 404 0.00107565031923359
primitive neuroectodermal tumor 3031 0.00168305723846006
oligodendroglioma 2849 0.00302289716602263
Waldenstrons macroglobulinemia 765 0.00325578195431848
pancreatic cancer 2300 0.00349654447641374
atypical teratoid / rhabdoid tumor 4369 0.00429049079591534
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00501131554524995
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00544768541760442
astrocytic glioma 2241 0.0071230804494507
ependymoma 2514 0.00780216086325566
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00793114080737617
Multiple myeloma 1328 0.00896806011364291
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0114634705087957
primary Sjogren syndrome 789 0.0416221204248391
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 1.0

Expression

Synonym

Accession O14980 A6NL14 A8K1K5 D6W5E2 Q63HP8 Q68CP3 Q99433 Exp1
Symbols emb
CRM1
exp1

Gene

PANTHER Protein Class (1)

PDB

5DIS   2L1L   1W9C   3GB8   4BSM   4BSN  

  Ortholog (16)

Gene RIF (210)

PMID Text
27012366 this regulation was conserved in HIV-2 and was dependent on the CRM1-dependent nuclear export pathway suggesting a role of the RNA helicase in interconnecting nuclear export with ribosome recruitment of the viral unspliced mRNA
26740045 The results indicate that highly selective targeting of Nup98-fusion proteins to Hox cluster regions via prebound Crm1 induces the formation of higher order chromatin structures that causes aberrant Hox gene regulation.
26733199 HIV-1 depends on host-cell-encoded factors to complete its life cycle; data suggest nucleus-located NAF1 (HIV Nef-associated factor 1) promotes nuclear export of un-spliced HIV-1 gag mRNA; association between NAF1 and CRM1 is required for this function.
26506250 our results elucidate that RanGAP1 is actively transported between the nuclear and cytoplasmic compartments, and that the cytoplasmic and NPC localization of RanGAP1 is dependent on CRM1-mediated nuclear export.
26349033 The binding of nuclear export signals to CRM1 in both orientations results in a large expansion in nuclear export signal consensus patterns and therefore a corresponding expansion of potential nuclear export signals in the proteome.
26340096 Ribosomal biogenesis appears to be a key component through which XPO1 contributes to tumor cell survival.
26055813 Together, our study identifies CRM1 as a valid target in ovarian cancer and provides a basis for the development of S109 in ovarian cancer.
26048327 review of physiological function of chromosome region maintenance 1 protein.
25996664 Findings indicate that exportin 1 protein (CRM1) is a valid target for the treatment of colorectal cancer.
25948791 Our study suggests SINE-mediated XPO1/CRM1 inhibition as a novel therapeutic option for DMPM.
More...

AA Sequence

MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFS      1 - 70
QNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQ     71 - 140
EWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQ    141 - 210
FVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYE    211 - 280
EQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEA    281 - 350
LHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM    351 - 420
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWS    421 - 490
WKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWK    491 - 560
FLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQV    561 - 630
HTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACK    631 - 700
AVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQ    701 - 770
MVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE    771 - 840
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAA    841 - 910
AQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVAN    911 - 980
LLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKH    981 - 1050
KRQMSVPGIFNPHEIPEEMCD                                                    1051 - 1071
//

Text Mined References (250)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
27012366 2016 DEAD-box RNA helicase DDX3 connects CRM1-dependent nuclear export and translation of the HIV-1 unspliced mRNA through its N-terminal domain.
26740045 2016 Chromatin-prebound Crm1 recruits Nup98-HoxA9 fusion to induce aberrant expression of Hox cluster genes.
26733199 2016 HIV-1 Nef-associated Factor 1 Enhances Viral Production by Interacting with CRM1 to Promote Nuclear Export of Unspliced HIV-1 gag mRNA.
26506250 2015 The Cellular Distribution of RanGAP1 Is Regulated by CRM1-Mediated Nuclear Export in Mammalian Cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26349033 2015 Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
26340096 2015 Ribosomal Biogenesis and Translational Flux Inhibition by the Selective Inhibitor of Nuclear Export (SINE) XPO1 Antagonist KPT-185.
26055813 2015 Novel reversible selective inhibitor of CRM1 for targeted therapy in ovarian cancer.
26048327 2015 Expression, function, and targeting of the nuclear exporter chromosome region maintenance 1 (CRM1) protein.
More...