Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.54
PubTator Score 6.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.610 0.000
medulloblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.000
ovarian cancer -1.100 0.000

Synonym

Accession O14978 B2R634 O43387 Q96H95
Symbols FPM315
ZSCAN44
ZKSCAN12

Gene

Gene RIF (1)

PMID Text
19887448 Genomic targets of the KRAB and SCAN domain-containing zinc finger protein 263.

AA Sequence

MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALSRLQELCHGWL      1 - 70
RPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQRELGRLRQQVTNHGRGTEVL     71 - 140
LEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQRDPQAVKERALSAPWLSLFPPEGNMEDKEM    141 - 210
TGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPS    211 - 280
VQSCKEGLSPRGPAPGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPE    281 - 350
GGMEQALAGASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR    351 - 420
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRHQRTHTGEKPY    421 - 490
KCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTHERERLYPFSECGEAVSDSTP    491 - 560
FLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGEKPYKCTLCGENFSHRSNLIRHQRIHTGEKP    561 - 630
YTCHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHTG                     631 - 683
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19887448 2010 Genomic targets of the KRAB and SCAN domain-containing zinc finger protein 263.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9256059 1997 Isolation of a cDNA encoding a widely expressed novel zinc finger protein with the LeR and KRAB-A domains.
More...