Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.11
PubTator Score 18.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.17906026562014E-8
lung adenocarcinoma 2714 1.18798583771008E-7
lung cancer 4473 2.51194119381479E-4
acute quadriplegic myopathy 1157 0.00145736703913379
invasive ductal carcinoma 2950 0.00246521409594315
dermatomyositis 967 0.00279451412241157
ovarian cancer 8492 0.00446253778002466
hereditary spastic paraplegia 313 0.00853725778539931
osteosarcoma 7933 0.0136286080770749
Multiple myeloma 1328 0.0168469757468691
Waldenstrons macroglobulinemia 765 0.0183779463154442
chronic lymphocytic leukemia 244 0.0183867146049073
aldosterone-producing adenoma 664 0.0193348073066847
Breast cancer 3099 0.0259889637897627
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.095 0.018
chronic lymphocytic leukemia 1.078 0.018
Multiple myeloma 1.016 0.017
osteosarcoma 1.011 0.014
posterior fossa group A ependymoma 1.400 0.000
hereditary spastic paraplegia -1.085 0.009
acute quadriplegic myopathy 1.039 0.001
lung cancer 1.200 0.000
Breast cancer 3.300 0.026
aldosterone-producing adenoma -1.334 0.019
lung adenocarcinoma 1.281 0.000
invasive ductal carcinoma 1.300 0.002
ovarian cancer 1.500 0.004
dermatomyositis 1.100 0.003

Synonym

Accession O14977 A6NCD5 Q6IBQ7 Q96D20 AZI
Symbols AZI
OAZI
AZIA1
OAZIN
ODC1L

Gene

PANTHER Protein Class (2)

PDB

4ZGZ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (9)

PMID Text
26305948 Data show the the interplay between the enzyme ornithine decarboxylase (ODC) and two regulatory proteins: antizyme (Az) and inhibitor (AzIN).
25813938 AzI1 fulfils an essential regulatory function in polyamine homeostasis and cell proliferation.
23844940 AZIN1 rs2679757 and TRPM5 rs886277 are associated with the risk of HBV-related liver cirrhosis in Chinese.
23291631 edited form has a stronger affinity to antizyme, and the resultant higher AZIN1 protein stability promotes cell proliferation through the neutralization of antizyme-mediated degradation of ornithine decarboxylase (ODC) and cyclin D1
21931692 AZ_95-176 is the minimal AZ peptide that is fully functioning in the binding of ODC and AZI and inhibition of their function.
21837750 minor allelic SNP variant in 12th exon of AZIN1 associated with slower rates of fibrosis progression favors expression of novel splice form, AZIN1 SV2, that inhibits expression of fibrogenic genes in hepatic stellate cells.
21586232 SNP rs2679757 in the AZIN1 gene is associated with the risk of HBV-related liver cirrhosis in Chinese patients.
20215859 Decreased ornithine decarboxylase is associated with prostate cancer.
15670771 This study also suggests that highly expressed AZI may be partly responsible for increased ODC activity and cellular transformation.

AA Sequence

MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKC      1 - 70
NSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELK     71 - 140
KIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVH    141 - 210
ALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSA    211 - 280
FTLAVNIIAKKVVENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFT    281 - 350
SSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI    351 - 420
TSDSMMKNFFFVPSCIQLSQEDSFSAEA                                              421 - 448
//

Text Mined References (25)

PMID Year Title
26305948 2015 Structural basis of antizyme-mediated regulation of polyamine homeostasis.
25813938 2015 A role for antizyme inhibitor in cell proliferation.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25416956 2014 A proteome-scale map of the human interactome network.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
23844940 2013 A candidate gene study for the association of host single nucleotide polymorphisms with liver cirrhosis risk in chinese hepatitis B patients.
23291631 2013 Recoding RNA editing of AZIN1 predisposes to hepatocellular carcinoma.
21931692 2011 Minimal antizyme peptide fully functioning in the binding and inhibition of ornithine decarboxylase and antizyme inhibitor.
21837750 2011 A polymorphism that delays fibrosis in hepatitis C promotes alternative splicing of AZIN1, reducing fibrogenesis.
21586232 2011 [Polymorphism of ornithine decarboxylase antizyme inhibitor 1 gene is associated with liver cirrhosis in Chinese hepatitis B patients].
More...