Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.70
PubTator Score 18.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.039 1.5e-03
aldosterone-producing adenoma -1.334 1.9e-02
Breast cancer 3.300 2.6e-02
Chronic Lymphocytic Leukemia 1.078 1.8e-02
dermatomyositis 1.100 2.8e-03
ependymoma 1.300 7.6e-09
hereditary spastic paraplegia -1.085 8.5e-03
invasive ductal carcinoma 1.300 2.5e-03
lung adenocarcinoma 1.281 1.2e-07
lung cancer 1.100 2.8e-02
Multiple myeloma 1.016 1.7e-02
osteosarcoma 1.011 1.4e-02
ovarian cancer -1.300 5.1e-03
Waldenstrons macroglobulinemia 1.095 1.8e-02

Synonym

Accession O14977 A6NCD5 Q6IBQ7 Q96D20 AZI
Symbols AZI
AZI1
OAZI
AZIA1
OAZIN
ODC1L

Gene

PANTHER Protein Class (2)

PDB

4ZGZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKC      1 - 70
NSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELK     71 - 140
KIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVH    141 - 210
ALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSA    211 - 280
FTLAVNIIAKKVVENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFT    281 - 350
SSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI    351 - 420
TSDSMMKNFFFVPSCIQLSQEDSFSAEA                                              421 - 448
//

Text Mined References (26)

PMID Year Title