Property Summary

NCBI Gene PubMed Count 48
Grant Count 20
R01 Count 8
Funding $4,034,950.74
PubMed Score 60.68
PubTator Score 46.51

Knowledge Summary

Patent (4,409)

Expression

  Differential Expression (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
25975492 This meta-analysis suggests that GAK rs1564282 C/T polymorphism is associated with increased susceptibility to Parkinson's disease--{REVIEW}
25914293 Data indicated that GBA and TMEM175/GAK significantly alter age at onset in PD.
25653444 AAK1 and GAK are critical regulators of HCV entry that function in part by activating EGFR, AP2M1, and NUMB, and as the molecular targets underlying the antiviral effect of sunitinib and erlotinib, respectively.
24510904 Cyclin-G-associated kinase is a binding partners of LRRK2, a candidate genes for risk for sporadic Parkinson disease, and part of a complex that promotes clearance of Golgi-derived vesicles through the autophagy-lysosome system.
24438162 GAK apo structure reveals a dimeric inactive state of the catalytic domain mediated by an unusual activation segment interaction.
24039160 The effects of rs11248051 and rs1564282 variants of GAK, and the rs3129882 variant of HLA-DRA, were investigated in Parkinson's disease patients.
23826309 neither the CT, TT genotypes nor the minor allele T of single nucleotide polymorphism rs1564282 were associated with Parkinson's disease among the subjects from Taiwan and Singapore.
23618683 rs11248060 significantly increasThis study found that the minor alleles of GAK rpopulationss1564282 and DGKQ e the risk of PD in Han Chinese .
23591012 Dominant negative mutants of IRAK4 and GAK show strong apoptotic effects in A498 cells under anoxia.
22262175 GAK as a regulator of dephosphorylation events under the control of the PP2A B'gamma subunit.
More...

AA Sequence

MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKR      1 - 70
LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESR     71 - 140
GPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQR    141 - 210
RALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPP    211 - 280
HDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPP    281 - 350
VGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM    351 - 420
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAPHLHTLYNICR    421 - 490
NMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC    491 - 560
DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVI    561 - 630
PLGVTVQGDVLIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDL    631 - 700
FQVNLEVEVEPRDRPSREAPPWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGS    701 - 770
PEAEPTDSDSPPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG    771 - 840
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQACKAPSSNTDL    841 - 910
LSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADPFGPLLPSSGNNSQPCSNPDL    911 - 980
FGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAWTETAASAVAP    981 - 1050
TPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ   1051 - 1120
TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFS   1121 - 1190
SRSDKKGPKTIAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP   1191 - 1260
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF                      1261 - 1311
//

Text Mined References (58)

PMID Year Title
26345367 2015 The clathrin-binding and J-domains of GAK support the uncoating and chaperoning of clathrin by Hsc70 in the brain.
25975492 2015 Quantitative assessment of the association between GAK rs1564282 C/T polymorphism and the risk of Parkinson's disease.
25914293 2015 Impact of Parkinson's disease risk loci on age at onset.
25653444 2015 AP-2-associated protein kinase 1 and cyclin G-associated kinase regulate hepatitis C virus entry and are potential drug targets.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24438162 2014 Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24039160 2013 Reaffirmation of GAK, but not HLA-DRA, as a Parkinson's disease susceptibility gene in a Taiwanese population.
More...