Property Summary

NCBI Gene PubMed Count 27
PubMed Score 54.66
PubTator Score 27.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.100 8.3e-03
Astrocytoma, Pilocytic -1.100 1.1e-04
Atopic dermatitis -1.500 3.0e-02
Breast cancer 1.800 1.4e-03
glioblastoma -1.400 2.7e-06
interstitial cystitis -1.400 5.0e-03
lung cancer 2.900 1.1e-03
medulloblastoma, large-cell 1.300 4.6e-02
nasopharyngeal carcinoma -1.800 1.8e-06
nephrosclerosis -2.098 2.9e-02
non-small cell lung cancer 1.009 5.6e-05
oligodendroglioma -1.100 5.8e-03
osteosarcoma -2.731 2.4e-04
pancreatic ductal adenocarcinoma liver m... -3.930 5.5e-04
pediatric high grade glioma -1.100 3.2e-05
pituitary cancer -1.400 6.7e-04
psoriasis -1.600 2.4e-04

Gene RIF (8)

AA Sequence

MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKP      1 - 70
FLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRA     71 - 140
KSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESW    141 - 210
RSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCI    211 - 280
VAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFV    281 - 350
KRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG    351 - 420
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGE    421 - 490
NVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLR    491 - 560
IQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL              561 - 620
//

Text Mined References (34)

PMID Year Title