Property Summary

NCBI Gene PubMed Count 26
Grant Count 47
R01 Count 34
Funding $3,386,938.48
PubMed Score 51.78
PubTator Score 27.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis -2.239 0.025
astrocytic glioma -1.100 0.008
oligodendroglioma -1.100 0.006
psoriasis -2.100 0.000
osteosarcoma -2.731 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell 1.300 0.046
Atopic dermatitis -1.500 0.030
pancreatic ductal adenocarcinoma liver m... -3.930 0.001
non-small cell lung cancer 1.009 0.000
lung cancer 3.300 0.000
interstitial cystitis -1.400 0.005
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.100 0.000
nasopharyngeal carcinoma -1.800 0.000
Breast cancer 2.100 0.000
pituitary cancer -1.400 0.001

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26284975 In mice Grassofermata decreased absorption of (13)C-oleate demonstrating its potential as a therapeutic agent.
24277691 Protective effects of breastfeeding are reflected in higher expression levels of SLC27A2, FASN, PPARalpha and INSR in blood cells.
24113382 these data support the conclusion that FATP2 has a dual function in the pathways linking the transport and activation of exogenous fatty acids.
22028793 even though hypoxia regulates the expression of FATP2 and FATP4 in human trophoblasts, mouse Fatp2 and Fatp4 are not essential for intrauterine fetal growth.
21768100 FATP2a functions in fatty acid transport and activation and provides specificity toward n-3 fatty acids in which the corresponding n-3 acyl-CoAs are preferentially trafficked into acyl-CoA pools destined for phosphatidylinositol incorporation
20965718 Observational study of gene-disease association. (HuGE Navigator)
17998437 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKP      1 - 70
FLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRA     71 - 140
KSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESW    141 - 210
RSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCI    211 - 280
VAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFV    281 - 350
KRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG    351 - 420
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGE    421 - 490
NVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLR    491 - 560
IQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL              561 - 620
//

Text Mined References (33)

PMID Year Title
26284975 2015 Fatty acid transport protein-2 inhibitor Grassofermata/CB5 protects cells against lipid accumulation and toxicity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24277691 2014 Influence of breastfeeding on blood-cell transcript-based biomarkers of health in children.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24113382 2013 Overexpression of human fatty acid transport protein 2/very long chain acyl-CoA synthetase 1 (FATP2/Acsvl1) reveals distinct patterns of trafficking of exogenous fatty acids.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22028793 2011 The expression and function of fatty acid transport protein-2 and -4 in the murine placenta.
22022213 2011 Overexpression of CD36 and acyl-CoA synthetases FATP2, FATP4 and ACSL1 increases fatty acid uptake in human hepatoma cells.
21768100 2011 Human fatty acid transport protein 2a/very long chain acyl-CoA synthetase 1 (FATP2a/Acsvl1) has a preference in mediating the channeling of exogenous n-3 fatty acids into phosphatidylinositol.
More...