Property Summary

NCBI Gene PubMed Count 81
Grant Count 260
R01 Count 141
Funding $27,931,951.44
PubMed Score 1183.04
PubTator Score 128.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession O14974 B4DZ09 F8VWB4 Q2NKL4 Q569H0 Q86WU3 Q8NFR6 Q9BYH0
Symbols MBS
M130
MYPT1

Gene

PDB

2KJY   5HUZ  

Gene RIF (35)

PMID Text
25168281 the relative expression of LZ+/LZ- MYPT1 isoforms, in part, defines the vascular response to NO and NO based vasodilators, and therefore, plays a role in the regulation of vascular tone in both health and disease
24972320 These results indicate that PPP1R12A indeed plays a role in skeletal muscle insulin signaling
24785407 Expression of NUAK1 is controlled by cyclin-dependent kinase, PLK1, and the SCFbetaTrCP (Skp, Cullin and F-boxbetaTrCP) E3 ubiquitin ligase complex.
24712327 distinct roles of two inhibitory phosphorylation sites of MYPT1
23419712 results suggested that during atherosclerosis progression oxidative stress mediates the downregulation of MYPT1, which may inhibit smooth muscle cell migration and contribute to the aberrant contractility
23345589 in apoptotic cells, the myosin-binding domain of myosin phosphatase targeting subunit 1 is cleaved by caspase-3, and the cleaved MYPT1 is strongly phosphorylated at Thr-696 and Thr-853, phosphorylation of which is known to inhibit myosin II binding
23168335 Mypt1 colocalizes outside the nucleus with Nkx2.5 in a manner dependent on Wnt signaling and Rho-associated protein kinase.
22869619 Calcineurin may modulate the phosphorylation level of MLC20 by influencing the phosphorylation state of MYPT1 to regulate endothelial barrier function.
22728334 These findings provide evidence for the involvement of a particular PP1 complex, PPP1R12A/PP1cdelta, in insulin signaling.
22641346 It found deoxyribonucleic acid (DNA) damage-induced LATS1 activation caused PLK1 suppression via the phosphorylation of MYPT1 S445.
More...

AA Sequence

MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYAN      1 - 70
VDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGD     71 - 140
TPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKG    141 - 210
YTEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYL    211 - 280
EELQKKQNLLHSEKRDKKSPLIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKK    281 - 350
DESSCSSEEDEEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK    351 - 420
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSLDNKEKEKDSK    421 - 490
GTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNSSVNEGSTYHKSCSFGRRQD    491 - 560
DLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSSSAGTQSSTSNRLWAEDSTEKEKDSVPTAV    561 - 630
TIPVAPTVVNAAASTTTLTTTTAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVT    631 - 700
LTDLQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYR    701 - 770
PVSTSSSTTPSSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI    771 - 840
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGS    841 - 910
YSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSLL    911 - 980
EMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK                        981 - 1030
//

Text Mined References (101)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25816133 2015 Tumor necrosis factor disrupts claudin-5 endothelial tight junction barriers in two distinct NF-?B-dependent phases.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25168281 2014 Differential phosphorylation of LZ+/LZ- MYPT1 isoforms regulates MLC phosphatase activity.
24972320 2014 Quantitative phosphoproteomics reveals novel phosphorylation events in insulin signaling regulated by protein phosphatase 1 regulatory subunit 12A.
24785407 2014 Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1?MYPT1 phosphatase complex and the SCF?TrCP E3 ubiquitin ligase.
24712327 2014 Reconstituted human myosin light chain phosphatase reveals distinct roles of two inhibitory phosphorylation sites of the regulatory subunit, MYPT1.
24356468 2013 Inactivation of the Hippo tumour suppressor pathway by integrin-linked kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255721 2013 ?-Arrestin regulation of myosin light chain phosphorylation promotes AT1aR-mediated cell contraction and migration.
More...