Property Summary

NCBI Gene PubMed Count 88
PubMed Score 1290.65
PubTator Score 128.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.033 3.8e-04
aldosterone-producing adenoma -1.136 2.0e-02
atypical teratoid / rhabdoid tumor -1.200 9.8e-03
colon cancer -1.500 2.9e-03
dermatomyositis 1.500 8.3e-04
group 4 medulloblastoma -1.100 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.4e-02
juvenile dermatomyositis 1.201 2.0e-10
medulloblastoma, large-cell -1.800 3.7e-04
ovarian cancer 1.300 5.6e-05
Pick disease 1.100 1.7e-03
psoriasis -1.200 2.2e-08
Rheumatoid arthritis 3.000 1.5e-05
Waldenstrons macroglobulinemia 1.091 1.2e-02

Protein-protein Interaction (2)

Gene RIF (39)

AA Sequence

MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYAN      1 - 70
VDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGD     71 - 140
TPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKG    141 - 210
YTEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYL    211 - 280
EELQKKQNLLHSEKRDKKSPLIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKK    281 - 350
DESSCSSEEDEEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK    351 - 420
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSLDNKEKEKDSK    421 - 490
GTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNSSVNEGSTYHKSCSFGRRQD    491 - 560
DLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSSSAGTQSSTSNRLWAEDSTEKEKDSVPTAV    561 - 630
TIPVAPTVVNAAASTTTLTTTTAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVT    631 - 700
LTDLQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYR    701 - 770
PVSTSSSTTPSSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI    771 - 840
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGS    841 - 910
YSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSLL    911 - 980
EMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK                        981 - 1030
//

Text Mined References (108)

PMID Year Title