Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.81
PubTator Score 8.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia -2.300 3.1e-02
adrenocortical carcinoma 1.863 1.3e-02
Astrocytoma, Pilocytic -1.600 3.4e-04
Breast cancer 1.700 2.4e-03
breast carcinoma 1.400 1.1e-03
chronic rhinosinusitis -1.157 4.6e-02
cystic fibrosis 4.327 1.7e-08
ductal carcinoma in situ 2.700 5.9e-03
Endometriosis -1.034 4.5e-02
group 3 medulloblastoma 3.200 1.8e-05
Hydrolethalus syndrome -1.191 2.8e-02
invasive ductal carcinoma 4.400 8.6e-04
lung carcinoma 2.400 5.6e-20
malignant mesothelioma -1.800 9.9e-06
medulloblastoma, large-cell 2.100 5.3e-05
mucosa-associated lymphoid tissue lympho... -1.159 1.1e-02
non-small cell lung cancer 1.134 5.6e-05
pituitary cancer -1.100 1.0e-03
posterior fossa group B ependymoma 1.500 1.8e-03
primitive neuroectodermal tumor 1.400 1.8e-02
psoriasis -1.600 8.1e-21
subependymal giant cell astrocytoma -1.488 4.0e-02

Gene RIF (6)

AA Sequence

MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGR      1 - 70
LAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQ     71 - 140
YEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHA    141 - 210
KPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDE    211 - 280
RAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPA    281 - 350
CRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS    351 - 420
DIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSF    421 - 490
CWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKS    491 - 560
EEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD                        561 - 610
//

Text Mined References (18)

PMID Year Title