Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.23
PubTator Score 8.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.12143391118233E-21
lung carcinoma 2844 5.5891064096019E-20
cystic fibrosis 1670 1.69349896032457E-8
malignant mesothelioma 3163 9.90829741958338E-6
group 3 medulloblastoma 2254 1.84042279156703E-5
medulloblastoma, large-cell 6234 5.32492471486071E-5
non-small cell lung cancer 2798 5.63907872623307E-5
pilocytic astrocytoma 3086 3.5468083990954E-4
invasive ductal carcinoma 2950 8.58622811122946E-4
pituitary cancer 1972 0.00100095621159779
breast carcinoma 1614 0.00113138050815152
posterior fossa group B ependymoma 1530 0.00176915024695811
Breast cancer 3099 0.00244065887433075
ductal carcinoma in situ 1745 0.00592876034775354
mucosa-associated lymphoid tissue lymphoma 480 0.0111472193305333
adrenocortical carcinoma 1427 0.0132039531118131
primitive neuroectodermal tumor 3031 0.0178905843565489
Hydrolethalus syndrome 128 0.0283288953415756
acute myeloid leukemia 785 0.0314431077065534
subependymal giant cell astrocytoma 2287 0.0398208412506765
Endometriosis 535 0.0449312864932276
chronic rhinosinusitis 512 0.0456020391226932
Disease Target Count Z-score Confidence
Male infertility 170 3.745 1.9

Expression

Synonym

Accession O14967 B3KS90 B4DXV8 D3DNY8
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Gene RIF (4)

PMID Text
24769397 Although their similarity in carbohydrate binding specificities is high, there seems to be some differences in the mode of substrate recognition between calmegin and calnexin.
22190034 HIV-1 gp120 is identified to have a physical interaction with calmegin (CLGN) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16264275 calmegin expression is regulated by histone deacetylase and CpG methyltransferase in a coordinative way

AA Sequence

MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGR      1 - 70
LAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQ     71 - 140
YEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHA    141 - 210
KPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDE    211 - 280
RAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPA    281 - 350
CRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS    351 - 420
DIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSF    421 - 490
CWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKS    491 - 560
EEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD                        561 - 610
//

Text Mined References (15)

PMID Year Title
24769397 2014 Glycan specificity of a testis-specific lectin chaperone calmegin and effects of hydrophobic interactions.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17507649 2007 A developmentally regulated chaperone complex for the endoplasmic reticulum of male haploid germ cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16264275 2005 Coordinated transcriptional regulation of calmegin,a testis-specific molecular chaperon, by histone deacetylase and CpG methyltransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...