Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.34
PubTator Score 13.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.600 2.5e-04
astrocytoma 1.400 4.6e-15
Astrocytoma, Pilocytic 1.400 7.7e-07
cutaneous lupus erythematosus 1.400 7.9e-04
ependymoma 1.200 2.5e-06
glioblastoma 1.400 2.8e-06
group 3 medulloblastoma -1.600 4.9e-04
head and neck cancer and chronic obstruc... 1.100 1.8e-04
lung cancer -2.000 3.1e-05
malignant mesothelioma -1.900 4.6e-08
medulloblastoma, large-cell -2.300 1.2e-07
oligodendroglioma 1.100 3.5e-07
osteosarcoma -1.390 5.0e-03
ovarian cancer -1.500 2.3e-04
Pick disease 1.500 1.1e-03
pituitary cancer -1.400 6.6e-06
subependymal giant cell astrocytoma 1.760 2.9e-02
ulcerative colitis 1.400 1.9e-04

Gene RIF (13)

AA Sequence

MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERF      1 - 70
TSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQID     71 - 140
RFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC           141 - 203
//

Text Mined References (30)

PMID Year Title