Property Summary

Ligand Count 898
NCBI Gene PubMed Count 556
PubMed Score 1158.02
PubTator Score 959.65

Knowledge Summary

Patent (76,823)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2499 5.447 2.7
Disease Target Count Z-score Confidence
Measles 22 4.819 2.4
Retinitis pigmentosa 62 3 4.373 2.2
Donohue syndrome 6 4.292 2.1
Disease Target Count
Carcinoma of colon 32
Kidney cancer 2613

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma 1.694 1.3e-04
adult high grade glioma 1.500 1.8e-04
Atopic dermatitis 1.400 3.7e-04
atypical teratoid / rhabdoid tumor 2.200 3.0e-09
Breast cancer 2.700 4.3e-02
breast carcinoma 1.400 2.2e-05
colon cancer 2.100 3.7e-02
cutaneous lupus erythematosus 1.100 4.0e-02
ductal carcinoma in situ 1.800 1.4e-03
Endometriosis 1.410 6.7e-03
esophageal adenocarcinoma 1.300 3.0e-02
glioblastoma 1.900 8.1e-09
group 3 medulloblastoma 2.200 9.4e-05
interstitial cystitis 1.100 1.2e-02
intraductal papillary-mucinous carcinoma... 2.100 1.2e-03
intraductal papillary-mucinous neoplasm ... 2.500 5.0e-04
invasive ductal carcinoma 2.400 1.6e-04
lung adenocarcinoma 1.300 2.1e-08
lung cancer 2.900 5.7e-04
medulloblastoma, large-cell 2.300 2.0e-07
nasopharyngeal carcinoma 1.200 1.2e-04
non-small cell lung cancer 2.633 1.8e-29
osteosarcoma -2.593 4.2e-03
ovarian cancer 2.400 2.1e-07
pancreatic cancer 1.300 5.0e-04
posterior fossa group A ependymoma 1.100 2.9e-03
primitive neuroectodermal tumor 2.200 2.7e-05
psoriasis 1.100 4.7e-05

PDB (138)

Gene RIF (523)

AA Sequence

MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKP      1 - 70
VQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLG     71 - 140
KGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLIL    141 - 210
EYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH    211 - 280
APSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPD    281 - 350
FVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS                     351 - 403
//

Text Mined References (577)

PMID Year Title