Property Summary

NCBI Gene PubMed Count 90
Grant Count 39
R01 Count 17
Funding $4,160,407.5
PubMed Score 704.30
PubTator Score 51.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.100 0.006
psoriasis 1.100 0.015
osteosarcoma 1.526 0.000
pancreatic ductal adenocarcinoma liver m... 1.180 0.005

 IMPC Term (1)

Gene RIF (45)

PMID Text
26819309 detailed analysis of the subcellular localization and functional significance of Hrs in macropinocytosis-mediated entry of Kaposi's Sarcoma-Associated Herpesvirus
26715116 Results demonstrate the existence of crosstalk between beta-catenin signaling and HGS in two different types of cancer (hepatoblastoma and colorectal).
26317613 Vpu interacts with HGS (HRS) via the HGS double-ubiquitin interaction motif, indicating this motif is the direct binding site for Vpu or ubiquitination of cargo mediates Vpu/HGS interaction or by factors associated in the degradation pathway
26317613 Vpu interacts with HGS (HRS) via the HGS double-ubiquitin interaction motif, indicating this motif is the direct binding site for Vpu or ubiquitination of cargo mediates Vpu/HGS interaction or by factors associated in the degradation pathway
26317613 Vpu interacts with HGS (HRS) via the HGS double-ubiquitin interaction motif, indicating this motif is the direct binding site for Vpu or ubiquitination of cargo mediates Vpu/HGS interaction or by factors associated in the degradation pathway
25296754 ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation.
24489825 Vpu interacts with HGS (HRS) via the HGS double-ubiquitin interaction motif, indicating this motif is the direct binding site for Vpu or ubiquitination of cargo mediates Vpu/HGS interaction or by factors associated in the degradation pathway
24204276 we identified an interaction between EsxH, which is secreted by the Esx-3 TSSS, and human hepatocyte growth factor-regulated tyrosine kinase substrate (Hgs/Hrs), a component of the endosomal sorting complex required for transport (ESCRT).
23867513 the role for tumoral c-Met expression or sMet/HGF levels as upfront selection criterion or predictive biomarkers deserve further study in this emerging area of therapeutic focus in RCC
22832105 Hrs is a regulator of endosomal cholesterol trafficking.
More...

AA Sequence

MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMES      1 - 70
VVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGH     71 - 140
VFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVR    141 - 210
VCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERL    211 - 280
RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSA    281 - 350
PVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV    351 - 420
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREE    421 - 490
HREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQM    491 - 560
PAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPS    561 - 630
MVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQ    631 - 700
SVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSE    701 - 770
AQLISFD                                                                   771 - 777
//

Text Mined References (106)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26819309 2016 ESCRT-0 Component Hrs Promotes Macropinocytosis of Kaposi's Sarcoma-Associated Herpesvirus in Human Dermal Microvascular Endothelial Cells.
26715116 2015 A kinome siRNA screen identifies HGS as a potential target for liver cancers with oncogenic mutations in CTNNB1.
25416956 2014 A proteome-scale map of the human interactome network.
25296754 2014 ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204276 2013 Mycobacterium tuberculosis type VII secreted effector EsxH targets host ESCRT to impair trafficking.
24105262 2013 Analysis of ESCRT functions in exosome biogenesis, composition and secretion highlights the heterogeneity of extracellular vesicles.
23867513 Targeting the hepatocyte growth factor/c-Met signaling pathway in renal cell carcinoma.
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
More...