Property Summary

NCBI Gene PubMed Count 38
PubMed Score 86.22
PubTator Score 61.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Amyloidosis 67 4.378 2.2

Expression

Gene RIF (26)

AA Sequence

MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPF      1 - 70
TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE     71 - 140
NCDSSDPTAYL                                                               141 - 151
//

Text Mined References (40)

PMID Year Title