Property Summary

NCBI Gene PubMed Count 31
Grant Count 11
R01 Count 8
Funding $1,334,213.93
PubMed Score 76.74
PubTator Score 61.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Amyloidosis 68 4.08 2.0

Gene RIF (19)

PMID Text
26048244 Localized LECT2 amyloidosis of the adrenal gland with coexisting MGUS: a diagnostic challenge.
25602789 LECT2 immunostain is useful in confirming subtype of amyloid within the liver in ALECT2..
25064673 First Nations people from British Columbia who presented with chronic kidney disease, were found to be due to LECT2 amyloidosis.
24892551 LECT2 is regulated by beta-catenin in HCC in both mice and men, but serum LECT2 reflects beta-catenin activity only in mice. Serum LECT2 could be a potential biomarker of HCC in patients.
24792621 The data from this study show that weak LECT2 staining should be regarded as indeterminate or a negative result and does not per se allow diagnosis of specific amyloid type. The diagnosis of LECT2 renal amyloidosis may require LMD/MS confirmation.
24522497 There were no mutations detected in the LECT2 gene, although all renal leukocyte chemotactic factor 2 amyloidosis patients tested were homozygous for the G nucleotide in a non-synonymous SNP at position 172.
24478397 These results demonstrate the involvement of LECT2 in glucose metabolism and suggest that LECT2 may be a therapeutic target for obesity-associated insulin resistance.
24451324 Amyloidosis derived from leukocyte chemotactic factor 2 (ALECT2) is a recently described disease. Here, we report the characteristics and outcome of 72 patients with renal ALECT2, which included 19 who had another kidney disease on biopsy.
24415538 ALect2 is a common cause of hepatic amyloidosis in the population of the United States, and subtyping hepatic amyloid deposits by an accurate analytic method such as MS is required for optimal clinical management of hepatic amyloidosis patients
24390366 The study indicates that serum LECT2 levels are increased by obesity and fatty liver, and suggests that LECT2 is a novel obesity-related protein.
More...

AA Sequence

MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPF      1 - 70
TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE     71 - 140
NCDSSDPTAYL                                                               141 - 151
//

Text Mined References (33)

PMID Year Title
26048244 2015 Localized LECT2 amyloidosis of the adrenal gland with coexisting MGUS: a diagnostic challenge.
25602789 2015 Globular hepatic amyloid is highly sensitive and specific for LECT2 amyloidosis.
25064673 2014 Renal leukocyte chemotactic factor 2 (LECT2) amyloidosis in First Nations people in Northern British Columbia, Canada: a report of 4 cases.
24892551 2014 Role of leukocyte cell-derived chemotaxin 2 as a biomarker in hepatocellular carcinoma.
24792621 2014 Leukocyte chemotactic factor 2 amyloidosis cannot be reliably diagnosed by immunohistochemical staining.
24522497 2014 Clinical, morphologic, and genetic features of renal leukocyte chemotactic factor 2 amyloidosis.
24478397 2014 LECT2 functions as a hepatokine that links obesity to skeletal muscle insulin resistance.
24451324 2014 Characterization and outcomes of renal leukocyte chemotactic factor 2-associated amyloidosis.
24415538 2014 Leukocyte cell-derived chemotaxin 2 (LECT2)-associated amyloidosis is a frequent cause of hepatic amyloidosis in the United States.
24390366 2013 Increased serum leukocyte cell-derived chemotaxin 2 (LECT2) levels in obesity and fatty liver.
More...